PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM74964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 437aa    MW: 47180.9 Da    PI: 5.7575
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM74964.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.72.1e-07242339
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg....Htv 39
                e+ C+ ++  ++  +C++++  lC  C  ++H+     H++
  OWM74964.1  2 EPSCDFCNAVRAVVYCKSDSARLCLRCDGYIHSAnslaHRH 42
                689******99*********************657888553 PP

2CCT62.71.1e-21366409144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R++a++RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  OWM74964.1 366 RDKAKMRYNEKKKTRMFGKQIRYASRKARADTRKRVKGRFVKAG 409
                 899**************************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    
MEPSCDFCNA VRAVVYCKSD SARLCLRCDG YIHSANSLAH RHSRSLLCDK CSCQPAIIRC  60
SDEKLSLCQG CEWNGQGCSG PGHSQQALNC YSGCPSMAEF SSIWASILDP PPSSGEFDNG  120
WGSYNGLSCN LERKGSEVCY GNTGPNKLTE LESWLGLPSS YTTHPNQMQF CRDQAPSMSP  180
DLNPPKVLPG CSGFKNLGVQ DSGADLCQNL NMDGLTNLGN GNDIIDCKTD QAQYQFEDGD  240
MECLLMGKNL PAPETNGPIE NIEASESGQP ECVAFQPSQL GNLILGMQYV KGGGGGGTNS  300
CMLMNPPNCN RNIGLGFPAS SKSLSLSNIT GESSASDYQD CGLSPMLLSV ESPWDPNLEG  360
SSPQARDKAK MRYNEKKKTR MFGKQIRYAS RKARADTRKR VKGRFVKAGE ANDYNPTGAT  420
MSFETEKATF PCKTSSC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.13e-92CO-like family protein