PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM65891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 352aa    MW: 37932.7 Da    PI: 6.4295
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM65891.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box254e-081960439
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                r C+ ++   + lfC+ ++ +lC  C +e+H g       H++
  OWM65891.1 19 RPCDSCKGAAAALFCRADSAFLCLGCDDEIH-GankvasrHER 60
                78******99*********************.54677777765 PP

2zf-B_box22.72e-0761103339
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 
                  + C+ +e+ ++   C+ +   lC +C   +H+       H +
  OWM65891.1  61 VWLCEVCEQAPAAVTCRADAAALCSSCDADIHSAnplarrHHR 103
                 689*****************************65788888655 PP

3CCT70.54.1e-24279322144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRYkeKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  OWM65891.1 279 REARVLRYKEKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 322
                 9*****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    
MGIGGERVNG GPGWRVPSRP CDSCKGAAAA LFCRADSAFL CLGCDDEIHG ANKVASRHER  60
VWLCEVCEQA PAAVTCRADA AALCSSCDAD IHSANPLARR HHRLPVEPLL DPSSAAGGHL  120
VKPSHMLHGL LLPQLPEDAD VPAVIDPEVG EVVKPVDPFF NDPYFDLDFG NSDGLNASGA  180
DGLVPVQSKP GPDPVELSPE KCLHVDFGRS AKLNGSFNLP AQTFTRTASS SSQDFGVVPD  240
GSEMSYPYIG SMSSSGLTEP SHNTHPINIQ ATQLSGVDRE ARVLRYKEKR KNRKFEKTIR  300
YASRKAYAES RPRIKGRFAK RTEVEGQLVD NIYGACPSVF FTDAEFGVVP TF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.19e-86CO-like family protein