PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM65184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 306aa    MW: 34604.1 Da    PI: 5.1144
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM65184.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box31.43.9e-1056101342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  ++C+ +e+ ++ l Ce +  +lC++C +e+H+       H +vp+
  OWM65184.1  56 VWVCNSCEKAPADLICEADAAFLCRSCDDEIHSAnvlaqrHVRVPV 101
                 689*****************************66888888888775 PP

2CCT67.82.9e-23243285143
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                 Rea++lRYkeK+k Rk+eKk+rY+sRKa+AesRpRvKGrF+++
  OWM65184.1 243 REAKVLRYKEKKKARKYEKKVRYASRKAYAESRPRVKGRFASK 285
                 9****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    
METVNLLGIS SCWSCDLCKA GARIFYCHDH SAYFCILCDQ RVHSISSAGP EQHERVWVCN  60
SCEKAPADLI CEADAAFLCR SCDDEIHSAN VLAQRHVRVP VKSVPCVASD QNEHADTLFD  120
FGGGYLGQEA CEEINDDETD SWLLLDPAIP DENLCPEYQP PDHSNYWDNS RCLKEPKQQE  180
YDLGKDAFIN SLSSQQTVPE SVTRISQKPA TITISNSYAM PLMGNSQIFL AGPPMIPCQM  240
MNREAKVLRY KEKKKARKYE KKVRYASRKA YAESRPRVKG RFASKLDIEL EVDQMFSLDE  300
YGCNLF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-35CO-like family protein