PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM65144.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 422aa    MW: 45546.7 Da    PI: 4.8959
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM65144.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.51e-061659340
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                +r C+ + + +++++C  ++ +lC  C  + H+       H++v
  OWM65144.1 16 ARACESCLKCRARWYCPADDAFLCGACDASVHSAnqlarrHERV 59
                578*****988*********************657788888876 PP

2CCT67.83e-23375418144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eKr+tR F+KkirY++RK +Ae+RpR+KGrFvk++
  OWM65144.1 375 REARVSRYREKRRTRMFSKKIRYQVRKLNAEKRPRMKGRFVKRT 418
                 9*****************************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    
MIADAKTANA VGGRTARACE SCLKCRARWY CPADDAFLCG ACDASVHSAN QLARRHERVR  60
LEAAPNPSTS HKSNGRSLKT STDDSNSVPA WHGGFTRKAR TPRKKFPGAD GGLAAKLPSP  120
GDLVPELSGE FDVSTGSMDE SDDIGLQCRV PVLDPFAEVG GCDLLGLGGG NGGTCDDELD  180
IGLLLPSEVD LEEFAADVKS LLGKEGLDLD EETGTEVKVK DELSGDDIML ELGDDETAEG  240
CNFEVAAAWE VAAEAAVGEM EFRSPVAAVG GDEVEEEKLV PAAAAGGDNK SSIHSNENEV  300
KPTKMLLRLN YEDVITAWAS HLSPWTNGTR PNLSPGDEWP DCMGSYASDV HNQHNYGGDA  360
MGLRGHSVGG DDKEREARVS RYREKRRTRM FSKKIRYQVR KLNAEKRPRM KGRFVKRTPC  420
FS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1386402RRTRMFSKKIRYQVRKL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-39CO-like family protein