PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OWM64464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica
Family CO-like
Protein Properties Length: 393aa    MW: 43233.7 Da    PI: 6.3144
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OWM64464.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52.1e-061960439
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                r C+++ +   + +C+ +  +lC  C +++H        H++
  OWM64464.1 19 RACDTCRSAACTVYCRADTAYLCTGCDSQIHAAnrvasrHER 60
                57******99*********************55567777765 PP

2zf-B_box31.63.5e-1061106342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  ++C+ +e+ ++ + C+ +   lC+ C + +H+       H++vp+
  OWM64464.1  61 VWVCQACERAPAAFLCKADAASLCAACDSDIHSAnplarrHQRVPI 106
                 689*****************************66899999**9997 PP

3CCT67.43.9e-23324367144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  OWM64464.1 324 REARVLRYREKKKMRKFEKTIRYASRKAYAETRPRIKGRFAKRT 367
                 9*****************************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    
MLNLKRESGG SSGDNTWARA CDTCRSAACT VYCRADTAYL CTGCDSQIHA ANRVASRHER  60
VWVCQACERA PAAFLCKADA ASLCAACDSD IHSANPLARR HQRVPILPIP PGAHCDPDGS  120
RYGPAGGHGN GLFLGQDGDE TVDEEEEDED EAASWLLLNP VKHNNSSNSN NNSINNTNQN  180
NGFVFGGEAD DYLDLVEYNS CTENQYSSGP YNQQHYGFPR KNYAGDSIVP VQCRESKDPL  240
QHHQNQQQNF HLGLDYEPSK AASSYNGSLC HSVSVSSMDV GIVPESTTSD ISISHSTSTA  300
PKGTIDLFSG PPVQMPTQLS PLDREARVLR YREKKKMRKF EKTIRYASRK AYAETRPRIK  360
GRFAKRTSVE IEVDQMFSTT IMTENGYGIV PSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1332338REKKKMR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-113CO-like family protein