PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0005418.1_g120.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 586aa    MW: 65401.4 Da    PI: 4.7369
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0005418.1_g120.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4549.6e-1392175862374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                ++lL++cA a+s+g+ + a++++++l++++s +gdp qR+aay++e+Laar+a+s++ +y++l+++e +   ss +laa+++++
  Pav_sc0005418.1_g120.1.mk 217 KQLLYNCAGALSEGNIKGASTMISELRQMVSIQGDPAQRIAAYMVEGLAARVASSGKIIYRSLKCKEPP---SSYRLAAMQVLF 297
                                589*****************************************************************9...9*********** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                                ev+P++kf++++aN aI ea + e++vHiiDfdisqG Q+++L+q+La+R ++pp+lR+Tgv++pes+      l+ +g+rL+k
  Pav_sc0005418.1_g120.1.mk 298 EVCPCFKFGFMAANGAIIEACKDEKKVHIIDFDISQGNQYITLIQTLANRLGKPPHLRLTGVDDPESVqrPVGGLNIIGQRLEK 381
                                ******************************************************************99888899********** PP

                       GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                                +Ae+l+vpfef++ va+r++ +++++L+++pgEal Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n++
  Pav_sc0005418.1_g120.1.mk 382 LAEALKVPFEFQA-VASRTSIVNTSMLDCRPGEALLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLRPKLVTVVEQDVNTNTT 464
                                *************.7********************************************************************* PP

                       GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                                +F+ rf+ea +yysa+fdsl+a lpres++r++vEr++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s+++++
  Pav_sc0005418.1_g120.1.mk 465 PFFPRFIEAYNYYSAVFDSLDAALPRESQDRMNVERQCLARDIVNIVACEGEERIERYEVAGKWRARMTMAGFTSCPMSTSITD 548
                                ************************************************************************************ PP

                       GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +++ l+r++ ++ y+v+ee g+l +gW++++L+++SaWr
  Pav_sc0005418.1_g120.1.mk 549 SIRELIRQYCDR-YKVKEEAGALHFGWENKSLIVASAWR 586
                                **********66.*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    
MSLVRPAELS TTSYRNFKLY SLKGSNDSST LSTQTFISDK HKTLYAADPD SAESYENLLD  60
SPMEEIAKPS SSGISGNSTN PQGDSSYQLR AGSVSSLNTQ NPFNTSLMSM RQHDAYQSNF  120
ESDYFESQSP DADSFDEDKM RLKLQELERA LLEDNDDEND EEINCSSQSM EVDGEWTDPI  180
QNELLHDSPK ESSSSESNVS SISSNKEITQ ASPQTPKQLL YNCAGALSEG NIKGASTMIS  240
ELRQMVSIQG DPAQRIAAYM VEGLAARVAS SGKIIYRSLK CKEPPSSYRL AAMQVLFEVC  300
PCFKFGFMAA NGAIIEACKD EKKVHIIDFD ISQGNQYITL IQTLANRLGK PPHLRLTGVD  360
DPESVQRPVG GLNIIGQRLE KLAEALKVPF EFQAVASRTS IVNTSMLDCR PGEALLVNFA  420
FQLHHMPDES VSTVNQRDQL LRMVKSLRPK LVTVVEQDVN TNTTPFFPRF IEAYNYYSAV  480
FDSLDAALPR ESQDRMNVER QCLARDIVNI VACEGEERIE RYEVAGKWRA RMTMAGFTSC  540
PMSTSITDSI RELIRQYCDR YKVKEEAGAL HFGWENKSLI VASAWR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0GRAS family protein