PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0003043.1_g130.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 532aa    MW: 59838.7 Da    PI: 4.591
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0003043.1_g130.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.51.5e-1111545251374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaal 81 
                                lv+ Ll+cAeav  +d++la++lL+++   +sp gd++qR+ ++f+ +L++rl+  +  ++  +++  + + +    +e+l a+
  Pav_sc0003043.1_g130.1.mk 154 LVHMLLACAEAVGCRDTKLAESLLSQIWASVSPWGDSLQRVSSCFAMGLRSRLSLlHNVNINGTFNNDTMDVSLtsREEKLEAF 237
                                689**************************************************9956666777776666554446689999*** PP

                       GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetger 164
                                +l+++++P++ f++++aN+aI +a++g+e +HiiD+++++ lQWp+L+++LasRpegpp +lRiTg+++   ++  ele+  + 
  Pav_sc0003043.1_g130.1.mk 238 QLLNQTTPYIAFGFMVANEAICQAAQGKENMHIIDLGMEHTLQWPSLIRTLASRPEGPPkKLRITGLVE--DHNVFELEAGMKA 319
                                *******************************************************988889********..569********** PP

                       GRAS 165 LakfAeelgvpfefnvlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqead 247
                                L + A++lg+p efn++ +  + + l+ e+L++++gEal Vn++++lh+ ++es  + +   ++L+++k+l P+v+++veq+a+
  Pav_sc0003043.1_g130.1.mk 320 LVEEASSLGIPTEFNMISEPvKPSLLTRENLDLREGEALFVNSIMHLHKYVKESRGSLK---AILQALKKLGPTVLTLVEQDAN 400
                                ****************744358999**************************88776666...9********************* PP

                       GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                                hn++ Fl rfle+l++ysa+fdslea+lpr+s +r+k+Er+ ++ ei+n+va eg +r+erhe++ +Wr++l++aGF+ + l+ 
  Pav_sc0003043.1_g130.1.mk 401 HNGPFFLGRFLESLHFYSAIFDSLEASLPRHSPQRMKIERQHFADEIRNIVAFEGLNRIERHERADQWRRQLGRAGFQVMGLK- 483
                                *******************************************************************************9996. PP

                       GRAS 332 kaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                  ++qa+++l+ ++ dgy++ +e+g+l+lgWk+rp++ +SaW+
  Pav_sc0003043.1_g130.1.mk 484 -CTSQARMMLSVYDCDGYTLASEKGCLLLGWKGRPIMLASAWQ 525
                                .679**************************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    
MEDFNGWLSF PFHESLNHDQ AIRRFCPARV EQEQGGEWEE ILNEIEISSP SETTSPPCLP  60
ASEVDDFVDS FINMDHCRDD DIQSSEKQQS FDYYDQDGME TFSMVDDMYG DVLMMMEGDD  120
MEMGGLAEDF GVGETNMVPS VEEVSHGVDQ GLHLVHMLLA CAEAVGCRDT KLAESLLSQI  180
WASVSPWGDS LQRVSSCFAM GLRSRLSLLH NVNINGTFNN DTMDVSLTSR EEKLEAFQLL  240
NQTTPYIAFG FMVANEAICQ AAQGKENMHI IDLGMEHTLQ WPSLIRTLAS RPEGPPKKLR  300
ITGLVEDHNV FELEAGMKAL VEEASSLGIP TEFNMISEPV KPSLLTRENL DLREGEALFV  360
NSIMHLHKYV KESRGSLKAI LQALKKLGPT VLTLVEQDAN HNGPFFLGRF LESLHFYSAI  420
FDSLEASLPR HSPQRMKIER QHFADEIRNI VAFEGLNRIE RHERADQWRR QLGRAGFQVM  480
GLKCTSQARM MLSVYDCDGY TLASEKGCLL LGWKGRPIML ASAWQVHNAS SS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-79GRAS family protein