PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0003033.1_g190.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 461aa    MW: 52344.3 Da    PI: 6.2812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0003033.1_g190.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.54.4e-137444561374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l++lL++cA++v+sg+ e+a+  L ++s+laspdgd+mqR+aayf eALa r+++ +++lykal++++ +  ++see+ + +lf
  Pav_sc0003033.1_g190.1.mk  44 LIQLLYSCANHVASGSIENANIWLDHISQLASPDGDTMQRIAAYFNEALADRMLKAWPGLYKALNSTKIT--SVSEEILVKRLF 125
                                689*************************************************************999998..5*********** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                                 +++P+lk++++++NqaI+ea+ege++vHiiD+   +++QW+ L+q+L++Rpegpp+lRiTg+++    +ke l ++ +rL++ 
  Pav_sc0003033.1_g190.1.mk 126 CDLCPFLKVAYVVTNQAIVEAMEGEKMVHIIDLHSCEPAQWIYLIQTLNARPEGPPHLRITGIHE----QKEVLDQMFHRLTEE 205
                                *****************************************************************....9************** PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll...................................... 214
                                A +l+++f+fn+ ++++le+l++e+Lrvk+gEalaV++vlqlh+ll                                      
  Pav_sc0003033.1_g190.1.mk 206 AGNLNISFQFNP-IVSKLENLDIESLRVKTGEALAVCSVLQLHSLLaadddlrrksplasknlqkvlhmnkltlgewlekdpis 288
                                ************.7999******************************************************************* PP

                       GRAS 215 .........desvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                                          +++s+ s +  ++L  +++lsPk++v++eqe++hn++++++r++eal++y alfd+le+++pr   er+kvE++
  Pav_sc0003033.1_g190.1.mk 289 aynlspdsaLSPLSSGSpKMGSFLTSLWGLSPKLMVITEQESNHNGHTLMDRIMEALNFYGALFDCLESTVPRSPMERQKVEKM 372
                                ******9884444444455678************************************************************** PP

                       GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                                l+g+ei+n++aceg+er+erhe+lekW  rle aGF+ vpls++ + qa++ l+ ++  g++++ee+g+lv++W+drpL+s+Sa
  Pav_sc0003033.1_g190.1.mk 373 LFGEEIKNIIACEGTERTERHEKLEKWILRLELAGFGRVPLSYHGMLQARRQLQGYE--GFKIKEENGCLVICWHDRPLFSISA 454
                                ********************************************************9..************************* PP

                       GRAS 373 Wr 374
                                Wr
  Pav_sc0003033.1_g190.1.mk 455 WR 456
                                *8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    
MAQEDGSPVT SSPLQFFPWL SPGMGSPYPT WLRELKSEER GLYLIQLLYS CANHVASGSI  60
ENANIWLDHI SQLASPDGDT MQRIAAYFNE ALADRMLKAW PGLYKALNST KITSVSEEIL  120
VKRLFCDLCP FLKVAYVVTN QAIVEAMEGE KMVHIIDLHS CEPAQWIYLI QTLNARPEGP  180
PHLRITGIHE QKEVLDQMFH RLTEEAGNLN ISFQFNPIVS KLENLDIESL RVKTGEALAV  240
CSVLQLHSLL AADDDLRRKS PLASKNLQKV LHMNKLTLGE WLEKDPISAY NLSPDSALSP  300
LSSGSPKMGS FLTSLWGLSP KLMVITEQES NHNGHTLMDR IMEALNFYGA LFDCLESTVP  360
RSPMERQKVE KMLFGEEIKN IIACEGTERT ERHEKLEKWI LRLELAGFGR VPLSYHGMLQ  420
ARRQLQGYEG FKIKEENGCL VICWHDRPLF SISAWRFRRY E
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0GRAS family protein