PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002544.1_g060.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 477aa    MW: 53016.4 Da    PI: 5.9333
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002544.1_g060.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.21.5e-93574742373
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl. 83 
                                ++lL++cA+a++++d++laq++L+ l+++a +dgd++qRl+  f++AL ar ar  + +l +a++ s+++ + +++++++ +l 
  Pav_sc0002544.1_g060.1.mk  57 EQLLVHCANAIETNDATLAQQILWVLNNIAPQDGDSNQRLTCAFLRALIARAARiGSCKLLAAMANSQANFTIHTHKFSVIELa 140
                                79****************************************************544567777777777766677777777778 PP

                       GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeelee 160
                                 f +++P+++f++ +aN aIleaveg + +Hi+Df++++++Q p+L +a+a R+    +pp l++T+ gs e +      ++ee
  Pav_sc0002544.1_g060.1.mk 141 sFIDLTPWHRFGFTAANAAILEAVEGYSVIHIVDFSLTHCMQIPTLVDAIAGRQegnVSPPLLKLTVAGSTEDVppmLDLSYEE 224
                                8*****************************************************554459**********888798888999** PP

                       GRAS 161 tgerLakfAeelgvpfefnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll...................... 214
                                +g++L +fA++ ++ +ef+v+        a+ +++l++++L   + gEal+Vn++++lh+++                      
  Pav_sc0002544.1_g060.1.mk 225 LGSKLVNFARSRNIILEFRVIpssytdgFANLIQQLRVQNLVYAEsGEALVVNCHMMLHYIPeetltlpsinpnpnlsssgsss 308
                                *********************8885555555555556666655559************************************** PP

                       GRAS 215 .........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                                         ++s +++s r+ +Lk++++l P++vv+v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  
  Pav_sc0002544.1_g060.1.mk 309 sygydvassSSSSTSSSLRTMFLKALRGLDPTIVVLVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD- 391
                                ******9976666666689****************************************************************. PP

                       GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                + ++i+nv+a eg++r+er e + +W +r+++a F++v+++e+a+ ++k++l +++  g+ ++ e++ +vl+Wk++++v+++aW
  Pav_sc0002544.1_g060.1.mk 392 VCWKIENVIAYEGFQRVERVEPKCRWVQRMRNANFRSVSFGEDAVLEVKAMLDEHA-AGWGLKREEEDVVLTWKGHNVVFATAW 474
                                99******************************************************.8999*********************** PP

Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    
MQFTEAPPPA LHQIITAPFS NLPMMNKNQT HRTRPWPGFP TSAKALGTNF GDANCMEQLL  60
VHCANAIETN DATLAQQILW VLNNIAPQDG DSNQRLTCAF LRALIARAAR IGSCKLLAAM  120
ANSQANFTIH THKFSVIELA SFIDLTPWHR FGFTAANAAI LEAVEGYSVI HIVDFSLTHC  180
MQIPTLVDAI AGRQEGNVSP PLLKLTVAGS TEDVPPMLDL SYEELGSKLV NFARSRNIIL  240
EFRVIPSSYT DGFANLIQQL RVQNLVYAES GEALVVNCHM MLHYIPEETL TLPSINPNPN  300
LSSSGSSSSY GYDVASSSSS STSSSLRTMF LKALRGLDPT IVVLVDEDAD LTSNNLVCRL  360
RSAFNYLWIP YDTVDTFLPR GSKQRQWYEA DVCWKIENVI AYEGFQRVER VEPKCRWVQR  420
MRNANFRSVS FGEDAVLEVK AMLDEHAAGW GLKREEEDVV LTWKGHNVVF ATAWMPA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-175GRAS family protein