PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002479.1_g590.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 515aa    MW: 57103.1 Da    PI: 6.3489
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002479.1_g590.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.71e-1101465151374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl 83 
                                lv++L++cAeav+ +d++ a++lL +l+ +a   g+++qR+a++f+++L+ rla  +  + +  + p ++s+  s+e+  al+l
  Pav_sc0002479.1_g590.1.mk 146 LVQQLIACAEAVACRDKAHASTLLYELRANAKVFGTSFQRVASCFVQGLSDRLALvQPLGAVGVIGPITKSTAFSAEKDEALHL 229
                                689***************************************************9333344555556666656699999***** PP

                       GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdi....sqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetg 162
                                 +e++P ++f+h++aN  Ilea+ege+ vH+iD+++    s+G QW +L+++La+R  ++ ++l+iTgvg+    s+e+l+++g
  Pav_sc0002479.1_g590.1.mk 230 VYEICPQIQFGHFIANASILEAFEGESSVHVIDLGMtlglSHGYQWRNLIDSLANRGgQPLHRLQITGVGN----SAERLQAIG 309
                                *********************************87522227999************9445569********....9******** PP

                       GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246
                                + L+ +A++++++fef++ v+++le+l+++++++  gE+l++n +lqlh l++es    +   +vL+++ +lsPk++v+veq++
  Pav_sc0002479.1_g590.1.mk 310 NDLKLLAQSTKLNFEFSA-VESSLENLKPQDFNLVDGEVLVINGILQLHCLVKESRGALN---SVLQTLHQLSPKLMVLVEQDT 389
                                ******************.799******************************88877777...8******************** PP

                       GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                                +hn++ Fl rf+eal+ ysa+fdsl+a lp+ +  r+k+E++++g+ei+n+v+ceg +r+erhe++e+Wr+r+++aGF+ +pl+
  Pav_sc0002479.1_g590.1.mk 390 SHNGPFFLGRFMEALHNYSAIFDSLDAMLPKYDTRRAKMEQFYFGEEIKNIVSCEGPARVERHERVEQWRRRMRRAGFQLAPLK 473
                                ***********************************************************************************7 PP

                       GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                    +qa   l+  + +gy+v e++g+lvlgWk++p++++S+W+
  Pav_sc0002479.1_g590.1.mk 474 M--IAQAMKWLEINACEGYTVVEDKGCLVLGWKSKPIIATSCWK 515
                                6..56788888888888**************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    
MASGLYAQAE FYGDNTSDEV IGLDLNLSSM ACLPDPSSLS TLEENPAAWV IPFIDETRSH  60
KRIKQQHSAS YEFNNAGTNY YSLYSGSGGM CARGLDSLPR IHFRDHILAY TRRYLAVEAM  120
EEATANLMRG KEGESGEGGR EDGTKLVQQL IACAEAVACR DKAHASTLLY ELRANAKVFG  180
TSFQRVASCF VQGLSDRLAL VQPLGAVGVI GPITKSTAFS AEKDEALHLV YEICPQIQFG  240
HFIANASILE AFEGESSVHV IDLGMTLGLS HGYQWRNLID SLANRGGQPL HRLQITGVGN  300
SAERLQAIGN DLKLLAQSTK LNFEFSAVES SLENLKPQDF NLVDGEVLVI NGILQLHCLV  360
KESRGALNSV LQTLHQLSPK LMVLVEQDTS HNGPFFLGRF MEALHNYSAI FDSLDAMLPK  420
YDTRRAKMEQ FYFGEEIKNI VSCEGPARVE RHERVEQWRR RMRRAGFQLA PLKMIAQAMK  480
WLEINACEGY TVVEDKGCLV LGWKSKPIIA TSCWK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-64GRAS family protein