PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002287.1_g050.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 742aa    MW: 80488.2 Da    PI: 5.9692
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002287.1_g050.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.41.7e-1013787412374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                 ++L+++Ae v +g+++ aq +Larl+++ sp g+p+qR+a+yf+eAL+  l+ + + +  + pp++ ++ +++ ++ a+k+fs
  Pav_sc0002287.1_g050.1.mk 378 LDQLYKAAELVGTGNFSHAQGILARLNHQLSPVGKPLQRAAFYFKEALQLLLLMNNPAT--SPPPRTPTPFDVIFKMGAYKVFS 459
                                679**************************************************955554..57888999999************ PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLak 167
                                evsP+++f ++t+Nqa+leav+  +++Hi+Dfdi+ G++W++++q+L  R+  + +pslRiT+++sp++++  el  ++++L++
  Pav_sc0002287.1_g050.1.mk 460 EVSPLIQFVNFTCNQALLEAVSDTDQIHIVDFDIGFGAHWASFMQELPVRNrgATAPSLRITAFASPSTHHPVELGLMRDNLTQ 543
                                ************************************************999556699*************************** PP

                       GRAS 168 fAeelgvpfefnvlvakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhn 249
                                fA+e+g++fe +v+  ++l++   +l  +r + +E++aVn+ +   ++ +++++l++    +L++vk+lsPk++v  ++ +d++
  Pav_sc0002287.1_g050.1.mk 544 FANEIGISFELEVVNFDSLDQSsySLPIFRANDNETVAVNFPI--WSTSNQPAALPN----LLRFVKQLSPKIMVSLDRGCDRS 621
                                *************98887777622444567777********99..666678999999....*********************** PP

                       GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                                + +F +++l+al+ y  l++sl+a    +s++ +k+Er+ll+++i++ v  + ++     e++  W+  + +aGF+pvp+s+++
  Pav_sc0002287.1_g050.1.mk 622 DLPFPQHILQALQSYINLLESLDAV-NVTSDAVNKIERFLLQPKIESTVLGRLRA----PEKMPLWKTLFASAGFTPVPFSNFT 700
                                **********************665.579*********************99998....9************************ PP

                       GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                ++qa++++++++ +g++ve++++slvl+W++r+L+s+SaWr
  Pav_sc0002287.1_g050.1.mk 701 ETQAECVVKRTPARGFHVEKRQESLVLCWQRRELISASAWR 741
                                ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    
MPFHFQQGKG VLEIANTSLA SIFTDNINSN SNKYLSQKDD CFFNNNSFVS SEPNSVLHMR  60
RSPSPPTSAS TLSSSFNGGG GGGGDKTTPL AAETSPPVGP ASTKDEWACE LQSIPSGGLE  120
AVTGSGGVER CGLGLGGLED WETMLSVTAA SPGQDQSLLR WIAGDVDDTS FGLKQLLQSG  180
NQNGSNNNNS NPLDFDGNAG LGIVDQGPGF DLIGSSVSGT SVSGPNFGFS SSGFVSNGNN  240
SSNGKVGFVP ASSGLLNYKV SNVGLMHNNN SGGGNSVNCN IQNPIFFNSS NTMALPVSLP  300
LGHAVYQQQQ FESSPDEKPQ ILNPQLFMNN QNQQSQLSQN PNFFMPLAYA QQEQHHLLQS  360
QAKRHNSGGI QQLQHTLLDQ LYKAAELVGT GNFSHAQGIL ARLNHQLSPV GKPLQRAAFY  420
FKEALQLLLL MNNPATSPPP RTPTPFDVIF KMGAYKVFSE VSPLIQFVNF TCNQALLEAV  480
SDTDQIHIVD FDIGFGAHWA SFMQELPVRN RGATAPSLRI TAFASPSTHH PVELGLMRDN  540
LTQFANEIGI SFELEVVNFD SLDQSSYSLP IFRANDNETV AVNFPIWSTS NQPAALPNLL  600
RFVKQLSPKI MVSLDRGCDR SDLPFPQHIL QALQSYINLL ESLDAVNVTS DAVNKIERFL  660
LQPKIESTVL GRLRAPEKMP LWKTLFASAG FTPVPFSNFT ETQAECVVKR TPARGFHVEK  720
RQESLVLCWQ RRELISASAW RC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-123GRAS family protein