PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002271.1_g350.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 552aa    MW: 62659.4 Da    PI: 8.2123
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002271.1_g350.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.71.5e-911675481373
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l++ Ll  A+av++++ + a + L++l + +s  gd++qR++ayf+ +Laarl+   s  ++ +  ++t    s+ee+ +++ +
  Pav_sc0002271.1_g350.1.mk 167 LIHMLLITATAVNENNVSSALENLSELYKSVSLCGDSVQRVVAYFADGLAARLLTRKSPFFDMIMKEPT----SAEEFVSFTSL 246
                                6899***************************************************99999988877777....5888899999* PP

                       GRAS  85 sevsPilkfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleet 161
                                + vsP+++f+h+taNqaI ea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s +el+et
  Pav_sc0002271.1_g350.1.mk 247 YRVSPYYQFAHFTANQAIIEAFEKEeeknnRALHVIDFDVSYGFQWPSLIQSLSEKAtsGNRISLRITGFGQ----SLDELRET 326
                                ***********************9977777788**********************99755566*********....9******* PP

                       GRAS 162 gerLakfAeel.gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                ++rL +f + + ++ fef+ l    l   +l +Lr k++E++aVnlv++l +l  +s+++++     Lk v  l+P +v++veq
  Pav_sc0002271.1_g350.1.mk 327 ENRLMSFSKGFrNLIFEFQGL----LRGSKLINLRKKRNETIAVNLVFHLNTLS-NSLKISD----SLKSVHLLNPSIVILVEQ 401
                                *********97579******8....66667789*****************9997.6666666....9***************** PP

                       GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpv 327
                                e +++  sFl rf+e+l+y++a+fdsl+  lpres er ++E+  lg+ei++++   +++    + e++e+W+ r+e+ GF+ +
  Pav_sc0002271.1_g350.1.mk 402 EGSRSPRSFLSRFMESLHYFAAMFDSLDDCLPRESAERLSIEKNHLGKEIKSMLNYDNDDvNCSKIEKMETWKTRMESHGFEGI 485
                                ********************************************************9999788999****************** PP

                       GRAS 328 plsekaakqaklllrkvk...sdgyrveee.............sgslv.lgWkdrpLvsvSaW 373
                                +ls+k   qa+lll+         ++ e++             +g  + lgW+dr L++vSaW
  Pav_sc0002271.1_g350.1.mk 486 NLSSKSKIQARLLLKIRThycPLQFEGESSggstagfkvfergDGRTIsLGWQDRYLLTVSAW 548
                                *************975441121223333225555555566667555556************** PP

Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    
MSNITTKVAC RGLSRFATFS LSRALSTATS ANETRTQKLE RIADELLDLT KIERHDYSIL  60
FRLKMGLNRY GPARDGGDGD TCREMEGIDE EELLNLSLAI VTTSGGERLK KRERRDHKNV  120
LVSPLNSYEG CEGKIFRLLQ MREQMLKQDH KKKGAHVLDE DGKGLHLIHM LLITATAVNE  180
NNVSSALENL SELYKSVSLC GDSVQRVVAY FADGLAARLL TRKSPFFDMI MKEPTSAEEF  240
VSFTSLYRVS PYYQFAHFTA NQAIIEAFEK EEEKNNRALH VIDFDVSYGF QWPSLIQSLS  300
EKATSGNRIS LRITGFGQSL DELRETENRL MSFSKGFRNL IFEFQGLLRG SKLINLRKKR  360
NETIAVNLVF HLNTLSNSLK ISDSLKSVHL LNPSIVILVE QEGSRSPRSF LSRFMESLHY  420
FAAMFDSLDD CLPRESAERL SIEKNHLGKE IKSMLNYDND DVNCSKIEKM ETWKTRMESH  480
GFEGINLSSK SKIQARLLLK IRTHYCPLQF EGESSGGSTA GFKVFERGDG RTISLGWQDR  540
YLLTVSAWNC VP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-51GRAS family protein