PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002233.1_g260.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 540aa    MW: 60469.5 Da    PI: 6.2005
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002233.1_g260.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.32e-1291715402374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                +++L++cA+a++++dl  a++l++ l +++s +g+p+qRl ay++e+L+arl rs+s +yk+l+++  +    +e ++++++++
  Pav_sc0002233.1_g260.1.mk 171 KDVLIRCAHAIAEDDLPTANSLMEVLGQMVSVSGEPIQRLGAYMLEGLRARLERSGSAIYKTLKCEVPT---GAELMSYMSVLF 251
                                789*****************************************************************9...9*********** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                                +++P+ +f+++ aN  I ea+e+e r+HiiDf+i qG QW++L+q La +p+gpp++RiTgv++++s   +   l+ +g++L++
  Pav_sc0002233.1_g260.1.mk 252 QICPYWRFAYMSANVVIREALENEPRIHIIDFQIAQGSQWVPLIQDLARQPGGPPRIRITGVDDSQSAhaRGGGLHIVGQKLSQ 335
                                ****************************************************************9988889999********** PP

                       GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                                +A++ +vpfefn  +a +  ++ele+Lr++pgEa+aVn+ + lh+++desvs++++rd++L+lvkslsPkv+++veqe+++n++
  Pav_sc0002233.1_g260.1.mk 336 LAKSWNVPFEFNN-AAMSGCEVELENLRIQPGEAIAVNFPYVLHHMPDESVSTQNHRDRLLRLVKSLSPKVMTLVEQESNTNTS 418
                                *************.89999***************************************************************** PP

                       GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                                +F+ rf+e +eyy+a+f+s+++  pr++++ri+ E ++++r+ivn++acegaer+erhe l+kW++rl++ GF+p+pls k+++
  Pav_sc0002233.1_g260.1.mk 419 PFFSRFVEMVEYYTAMFESIDVARPRDDKQRISAEMHCVARDIVNMIACEGAERVERHELLGKWKSRLTMDGFTPYPLSPKVTE 502
                                ************************************************************************************ PP

                       GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                 +++ll++++++ y ++e +g+l+l+Wk+r+Lv+ SaWr
  Pav_sc0002233.1_g260.1.mk 503 AIRSLLKEFNGN-YGLQEANGALYLCWKQRALVTSSAWR 540
                                **********77.*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    
MQTSQKHRST AGIHRLYHHQ PMQDIDPSIF QILENSVCSD TGSQGNNVSF QTYKEEYFTL  60
ESSPATTGFV ACDSPSVVSG LSNRSPFSSQ GSQSCLSDQH HSPDNTSGSP ISGCSVTDDG  120
NGLRYKLREL EISLLGPESD IIVDSHYCCY KSDMLRWNRN QIAEMTNLNL KDVLIRCAHA  180
IAEDDLPTAN SLMEVLGQMV SVSGEPIQRL GAYMLEGLRA RLERSGSAIY KTLKCEVPTG  240
AELMSYMSVL FQICPYWRFA YMSANVVIRE ALENEPRIHI IDFQIAQGSQ WVPLIQDLAR  300
QPGGPPRIRI TGVDDSQSAH ARGGGLHIVG QKLSQLAKSW NVPFEFNNAA MSGCEVELEN  360
LRIQPGEAIA VNFPYVLHHM PDESVSTQNH RDRLLRLVKS LSPKVMTLVE QESNTNTSPF  420
FSRFVEMVEY YTAMFESIDV ARPRDDKQRI SAEMHCVARD IVNMIACEGA ERVERHELLG  480
KWKSRLTMDG FTPYPLSPKV TEAIRSLLKE FNGNYGLQEA NGALYLCWKQ RALVTSSAWR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0GRAS family protein