PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0002106.1_g340.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 652aa    MW: 73008.4 Da    PI: 4.7897
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0002106.1_g340.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS256.97.3e-792265821359
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalk 82 
                                lve Ll+ Ae v  ++ e+a +lL+r   l+s++g++++R++ yf eAL++++ r ++  + k l  +++ + n   +  + ++
  Pav_sc0002106.1_g340.1.mk 226 LVEFLLASAEKVGYQQYERAGKLLNRCDLLSSSTGNSVERVVYYFSEALQEKIDReTGRVTPKGLGNKPSFDVNkAMKGPNETS 309
                                57889**************************************************33444445554444333332333333333 PP

                       GRAS  83 l.fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetger 164
                                l  +   P+ ++++++  qaI+e v+++++vH+iD++i +G+QW  L+qaLasR++ p   l+i ++g    +s+  +eetg+r
  Pav_sc0002106.1_g340.1.mk 310 LaCQIKIPFGQVAQFAGIQAIVENVAEAKKVHVIDLEIRNGVQWTGLMQALASRSDCPVeLLKISAIGT---SSRILIEETGKR 390
                                3356668************************************************6655499*******...57999******* PP

                       GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                                L++fAe++++pf+f+++++ ++ dl+ ++++++++E++aV + +++ ++++++  les     ++++k+++P v vv+e e +h
  Pav_sc0002106.1_g340.1.mk 391 LESFAESMNLPFSFKLVMVPDMLDLKEDMFELDSEETVAVYSEFAMRSMVAQPDRLES----AMRVIKNIRPCVTVVTEVEGNH 470
                                ****************9999******************************99999999....********************** PP

                       GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                                ns+ F++rf+eal ++ a fd++e+ + r++ +r+ +E  ++g+ ++n+va+eg+er+ rh +   Wr+ + + G++++  s +
  Pav_sc0002106.1_g340.1.mk 471 NSPVFVTRFIEALFFFGAYFDCVETCMERNDPNRMILESLYFGNGLRNIVAAEGEERKIRHVKIDIWRAFFARYGMEEIDWSPS 554
                                ************************************************************************************ PP

                       GRAS 333 aakqaklllrkvk.sdgyrveeesgslv 359
                                   q++l+l++++ +   +v+ + ++l+
  Pav_sc0002106.1_g340.1.mk 555 SLYQVDLVLKNFScGSSCTVNMDGKCLL 582
                                *************888888888888875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    
MTNAMFSFGE FNFSGVQDKL SSTDKGSDII MEEVNNIGKQ VRSYEADNLG DSGGFGSLGS  60
DYGFYGNNHY SSELLFPKFQ QQEERQPLVS DYGLFDAMQF DALSPPFQAC LEEIAKLEDI  120
PTLVPHVEPK KEKRDFSSLA GLDLLNNYGS GFKRLNGDRI FESSNYTACT DQVAGRKLST  180
EEIMRVAGAR FIRTSSQASG VASMLSHPYE LSFSGLSVEE TRDVELVEFL LASAEKVGYQ  240
QYERAGKLLN RCDLLSSSTG NSVERVVYYF SEALQEKIDR ETGRVTPKGL GNKPSFDVNK  300
AMKGPNETSL ACQIKIPFGQ VAQFAGIQAI VENVAEAKKV HVIDLEIRNG VQWTGLMQAL  360
ASRSDCPVEL LKISAIGTSS RILIEETGKR LESFAESMNL PFSFKLVMVP DMLDLKEDMF  420
ELDSEETVAV YSEFAMRSMV AQPDRLESAM RVIKNIRPCV TVVTEVEGNH NSPVFVTRFI  480
EALFFFGAYF DCVETCMERN DPNRMILESL YFGNGLRNIV AAEGEERKIR HVKIDIWRAF  540
FARYGMEEID WSPSSLYQVD LVLKNFSCGS SCTVNMDGKC LLVHINLIAK LLHNLLVPVL  600
HLSPNPVCKL VHLVLLVLAE LGLEPLPCIW ARRNNWVEDH ESMILCTWLV NC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-52GRAS family protein