PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001812.1_g030.1.br
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 107aa    MW: 12991.9 Da    PI: 9.1071
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001812.1_g030.1.brgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS90.23.4e-282105271374
                       GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                                +e++lpre+++r   E+e++gr++ nv+aceg++r+er et+++W+ r ++aGF+++pl++++ k++++++   + + + v+e+
  Pav_sc0001812.1_g030.1.br   2 FEETLPREDQQRLLFEKEVFGRDVINVIACEGSRRFERPETYKQWQFRNKRAGFRQLPLDQEILKKVRSMVTSEYHKDFVVDED 85 
                                6899*******************************************************************9999888****** PP

                       GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                                  ++++gWk+r + ++S W+
  Pav_sc0001812.1_g030.1.br  86 GMWVLQGWKGRIIHAISYWK 105
                                *******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    
MFEETLPRED QQRLLFEKEV FGRDVINVIA CEGSRRFERP ETYKQWQFRN KRAGFRQLPL  60
DQEILKKVRS MVTSEYHKDF VVDEDGMWVL QGWKGRIIHA ISYWKPV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.14e-42GRAS family protein