PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001699.1_g490.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 851aa    MW: 92209 Da    PI: 6.8139
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001699.1_g490.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.45e-1274798382374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                 +lLl+cAeavs++++ +a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y++lpps  + +++++ ++a+++f+
  Pav_sc0001699.1_g490.1.mk 479 LTLLLQCAEAVSADNFDEATKILLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYASLPPSYVPISHTQKMVSAFQVFN 562
                                579********************************************************************************* PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169
                                 +sP++kfsh+taNqaI ea+e+e+rvHi+D+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA
  Pav_sc0001699.1_g490.1.mk 563 GISPFVKFSHFTANQAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMEALEATGKRLSDFA 642
                                ****************************************************************....**************** PP

                       GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                                ++lg+pfef + va+++ +l++e+L+++++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sF
  Pav_sc0001699.1_g490.1.mk 643 DKLGLPFEFFP-VAEKVGSLNPERLNISKREAVAVHWLQ--HSLYDVTGSDSN----TLWLLQRLAPKVVTVVEQDLSH-AGSF 718
                                ***********.7*************************9..999999999999....**********************.899* PP

                       GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                                l rf+ea++yysalfdsl a++++eseer++vE++ll+rei+nv+a  g +r  + + + +Wre+++++GF+ ++l  +aa+qa
  Pav_sc0001699.1_g490.1.mk 719 LGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGEVK-FYNWREKFQQSGFRGISLAGNAATQA 801
                                ***************************************************888776.************************** PP

                       GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                 lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  Pav_sc0001699.1_g490.1.mk 802 TLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWR 838
                                ************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    
MAACALLGDH NGDHISGNGS SNNNSHGGGS PSCPMTSTTN SNSQGSSVEQ QPPRQHQNQQ  60
QQQRQSTEGS KMVRKRMACE IEVQNNPTSR NTSASDYMRL SRRSSSIINN NPNPNATKVN  120
NNSMVYPNYS TMLLPVPSST NLTTLTSAGG ALSPASASAS SAAASAANWG PIDPLSLHHH  180
HQSGALPPHQ LQLQPQTLTP AVCGFSGLPL FPPEKTTPSN QSTATPSSIS ISMEDSSSAT  240
AWIDGIIKDL IHSSTNVSIP QLIHNVREII FPCNPNLASL LEYRLRSISE PPPPPPPIPN  300
FNPATVPELR RRREALQLQQ QQNQHHHHHH HQGPGALKLN LDSATLHDVA IFTNPTTAET  360
ASVATHVMNS NDLYLHSWTG GGGGAGPTPI TCSQTNPHHP NSPFNQAIHH TQDKQLENSS  420
SSSPAAESTT PTAAPATTTT ATTTPTPPPT TPSAAVSLIR ERKEEMRQQK RDEEGLHLLT  480
LLLQCAEAVS ADNFDEATKI LLEISELSTP FGTSAQRVAA YFSEAMSARL VSSCLGIYAS  540
LPPSYVPISH TQKMVSAFQV FNGISPFVKF SHFTANQAIQ EAFEREDRVH IVDLDIMQGL  600
QWPGLFHILA SRPGGPPYVR LTGLGTSMEA LEATGKRLSD FADKLGLPFE FFPVAEKVGS  660
LNPERLNISK REAVAVHWLQ HSLYDVTGSD SNTLWLLQRL APKVVTVVEQ DLSHAGSFLG  720
RFVEAIHYYS ALFDSLGASY GEESEERHVV EQQLLSREIR NVLAVGGPSR SGEVKFYNWR  780
EKFQQSGFRG ISLAGNAATQ ATLLLGMFPS DGYTLVEDNG TLKLGWKDLC LLTASAWRPP  840
FHATTNPNLH Y
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein