PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001580.1_g470.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 549aa    MW: 61341.5 Da    PI: 6.309
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001580.1_g470.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS261.82.4e-801575412374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                ++lL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL+++l++s ++ +++ pp + ++++     ++l  f+
  Pav_sc0001580.1_g470.1.mk 157 EQLLNPCALAITGGNLTRVQHLLYVLHELASLTGDANHRLAAHGLRALNQHLSSSAPNGSASAPPVTFASTEPRFFQKSLLKFY 240
                                689*****************************************************************98888888888888** PP

                       GRAS  86 evsPilkfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg........... 153
                                evsP++ f + +aN+ Il+ +++e    + +Hi+D ++s+G+QWp+Ll+aL+ Rp ++pp ++iT+v++++++           
  Pav_sc0001580.1_g470.1.mk 241 EVSPWFAFPNNIANSSILQLIAEEsdrtRNLHIVDVGVSHGMQWPTLLEALTRRPgGPPPLVKITVVSAAANTennqnrenret 324
                                *******************999998777889************************55566********9888888877766555 PP

                       GRAS 154 ...skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                                         +   rL +fA+++++++++n l  + l++l+ + ++++++E+l+V+++++lh+l    +++++er+e+Lk+++++
  Pav_sc0001580.1_g470.1.mk 325 pfsMGPPGDNFSFRLLSFAKSMNINLQINRLDIQPLQSLNAQVIDTSNDEMLIVCVQFRLHNLN---HNTPDERTEFLKALRNM 405
                                5444445566778**************************************************8...77777889********* PP

                       GRAS 235 sPkvvvvveqeadh...nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                                +Pk v+++e+++++   n ++F ++f++ +ey + ++ds+++ +    + r + Er++++ e+ ++++++g++    +e +ekW
  Pav_sc0001580.1_g470.1.mk 406 EPKGVILSENNMECscnNCGDFTTGFSRQVEYLWRFLDSTSSAF----KGRESDERRVMEGEAAKALTNRGEM----NEGKEKW 481
                                **********9665446778********************6665....5555556666666699999999998....9****** PP

                       GRAS 316 rerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                 er++ +GF    ++e+a +  ++llrk++ ++++rv+e++g++ l Wk++p+ ++S W+
  Pav_sc0001580.1_g470.1.mk 482 CERMRGVGFVGQVFTEDAIDGGRALLRKYDsNWEMRVDEKDGCAGLWWKGQPVSFCSLWK 541
                                ******************************9999*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    
MTTQEPEPNS TSDHILDWLE DSVTFFPTFL DDPYHSNDIN GLPWWDESHD LIHSNTTSTS  60
LNNPSSIAFP TTTRPPNPTN LNHQSPSDSS KKRKVSDDQH IDQKNHVRPI SQAGQGDQLV  120
EEVVVPVKRT NGNKKGTAKT TGNNCNNGNS KEGRWAEQLL NPCALAITGG NLTRVQHLLY  180
VLHELASLTG DANHRLAAHG LRALNQHLSS SAPNGSASAP PVTFASTEPR FFQKSLLKFY  240
EVSPWFAFPN NIANSSILQL IAEESDRTRN LHIVDVGVSH GMQWPTLLEA LTRRPGGPPP  300
LVKITVVSAA ANTENNQNRE NRETPFSMGP PGDNFSFRLL SFAKSMNINL QINRLDIQPL  360
QSLNAQVIDT SNDEMLIVCV QFRLHNLNHN TPDERTEFLK ALRNMEPKGV ILSENNMECS  420
CNNCGDFTTG FSRQVEYLWR FLDSTSSAFK GRESDERRVM EGEAAKALTN RGEMNEGKEK  480
WCERMRGVGF VGQVFTEDAI DGGRALLRKY DSNWEMRVDE KDGCAGLWWK GQPVSFCSLW  540
KTDVKVINS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-155GRAS family protein