PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001543.1_g140.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 602aa    MW: 66623.5 Da    PI: 9.5389
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001543.1_g140.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.18.8e-1152405993374
                       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                                 lLl+cAe+v+ ++le+a+ lL ++ el+sp g++ +R+ ayf+ AL++r+ +s+ ++y+ l++++ +  +s++ ++al+ ++ 
  Pav_sc0001543.1_g140.1.mk 240 GLLLQCAECVAMDSLEEASDLLPEIAELSSPFGSSPERVGAYFAHALQTRVISSCLGTYSPLTTKTLTLAQSQRIFNALQSYNS 323
                                58******************************************************************99************** PP

                       GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                                +sP++kfsh+t NqaI +a++ge++vH+iD+di+qGlQWp L++ LasR+++  s+RiTg+gs    s+e le+tg+rLa+fA+
  Pav_sc0001543.1_g140.1.mk 324 ISPLVKFSHFTSNQAIFQALDGEDHVHVIDLDIMQGLQWPGLFHILASRSKKIRSMRITGFGS----SSELLESTGRRLADFAS 403
                                ***************************************************************....9**************** PP

                       GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                                +lg+pfef++l  k  +  +l++L v+p+Ea++V++++  h l+d ++s       +L+l+ sl+Pk+++++eq+++h s+sFl
  Pav_sc0001543.1_g140.1.mk 404 SLGLPFEFQPLEGKIGSITDLSQLGVRPDEATVVHWMH--HCLYDVTGSDLA----TLRLLGSLRPKLITIAEQDLSH-SGSFL 480
                                **********988888999******************9..888877777777....**********************.899** PP

                       GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                                 rf+eal+yysalfd+l  +l+++s er++vE++l+g ei+n++a  g +r+ + + +e+W + l+++GF+pv+l+ + a+qa+
  Pav_sc0001543.1_g140.1.mk 481 GRFVEALHYYSALFDALGDGLGADSLERHMVEQQLFGCEIRNILAVGGPKRTGEVK-VERWGDELKRVGFRPVSLGGNPAAQAS 563
                                **************************************************998887.9************************** PP

                       GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                lll +++++gy++ ee+g+l lgWkd +L+++SaW+
  Pav_sc0001543.1_g140.1.mk 564 LLLGMFPWKGYTLVEENGCLKLGWKDLSLLTASAWQ 599
                                ***********************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    
MVKFLKPNKA IIILQGRYAG RKAVIVRAFD DGTRDRPYGH CLVAGIKKYP SKVIRKDSAK  60
KTAKKSRVKP FVKLVNYQHL MPTRYTLDVD LKDVVNVEAF ATKDKKVTAL KETKKRFEER  120
FKTGKNRWFF TKLSFLIFIF SITLSTIAHT HHLLTVMLQS LVPQSPIGAA NPNNNPSSSS  180
SSMKTKRVDR DLAGGESSGE DPSFTKRPNS SRNFSREKTS DERETEPVAE GESAGLRLLG  240
LLLQCAECVA MDSLEEASDL LPEIAELSSP FGSSPERVGA YFAHALQTRV ISSCLGTYSP  300
LTTKTLTLAQ SQRIFNALQS YNSISPLVKF SHFTSNQAIF QALDGEDHVH VIDLDIMQGL  360
QWPGLFHILA SRSKKIRSMR ITGFGSSSEL LESTGRRLAD FASSLGLPFE FQPLEGKIGS  420
ITDLSQLGVR PDEATVVHWM HHCLYDVTGS DLATLRLLGS LRPKLITIAE QDLSHSGSFL  480
GRFVEALHYY SALFDALGDG LGADSLERHM VEQQLFGCEI RNILAVGGPK RTGEVKVERW  540
GDELKRVGFR PVSLGGNPAA QASLLLGMFP WKGYTLVEEN GCLKLGWKDL SLLTASAWQP  600
LD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105116KKVTALKETKKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein