PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001405.1_g1380.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 644aa    MW: 70351.8 Da    PI: 7.1968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001405.1_g1380.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3373.5e-1032736442374
                        GRAS   2 velLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                 ++ L+e+A+a+s+g+ e+a ++L+rl +    +p+ ++ qRl  +++ AL++r++     + +  p++e     s+e++ +++
  Pav_sc0001405.1_g1380.1.mk 273 KQSLMEAATAISEGKSEAAAEILTRLTTSqvPNPRPNSEQRLLEVMALALKTRVNP----VDNPPPVTE---LFSQEHAGSTQ 348
                                 578**********************988744677779******************9....443333333...3499******* PP

                        GRAS  83 lfsevsPilkfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeelee 160
                                 l++++sP+++f++++aN aIlea+ ++    ++vH+iDfdi+qG+Q++ Ll+aL++R +g p +++iT+v++  +g +++l  
  Pav_sc0001405.1_g1380.1.mk 349 LLYDLSPCFRFGFMAANLAILEATLTDksatNKVHVIDFDIGQGGQYVLLLHALSARLNGMPaTVKITTVAD--NGGEDRLTM 429
                                 ***********************9777678899*************************88776*********..77******* PP

                        GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                 ++++L+k+A++ gv +efn+ v+++l +l+ e+L ++p+E +aVn++++l++++desvs++++rde+L+ vk+lsP+vv++ve
  Pav_sc0001405.1_g1380.1.mk 430 VRQNLSKVAKQQGVVLEFNI-VSQKLGELNRESLGCEPDEPIAVNFAFKLYSMPDESVSTDNPRDELLRRVKGLSPRVVTLVE 511
                                 *******************9.8************************************************************* PP

                        GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                                 qe+++n+++F++r+ e++ yy al++s++ + +r+++er+k E++ l+r++ n vaceg++r+er+e ++kWr+r+++aGF+ 
  Pav_sc0001405.1_g1380.1.mk 512 QELNTNTAPFMARVKETCGYYGALLESMKWTEGRDNSERVKAEEA-LSRKLINSVACEGRDRVERCEVFGKWRARMGMAGFEL 593
                                 ****************************9999*************.************************************* PP

                        GRAS 327 vplsekaakqaklllrkvk...sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                  p+s+++++  k  l+  +   + g++v+ee+g +++gW +r+L+++SaWr
  Pav_sc0001405.1_g1380.1.mk 594 RPMSQNVTEILKQRLSSGNnrvNSGFTVKEENGGVCFGWISRTLTVASAWR 644
                                 *******999988886544235789*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    
MQSGFTGGAG AGGVPDFYAG GRSISIATAM NNHHQHPSQP PYHRSSLPGL FLDTSSSQIA  60
RQTQSQSQFQ NQNPSTFTGK RTLAEFQAHQ QQHHYHNPNQ NLYLRSLKPR TFQHSSPISP  120
LSPIDFSSSS TITGSDSSSS ASSLMSHQRF GLPLLQQLRP QPVHQTLPPA GSFVNNNPVQ  180
NQTRVVSGVD SEKKMISNRL QELEKQLLDD NDEEDEGDAV SVITKTSSEW SETIQNLIGP  240
GPSQSQKPVS PSPTSSSSSS SSVASPASST CSKQSLMEAA TAISEGKSEA AAEILTRLTT  300
SQVPNPRPNS EQRLLEVMAL ALKTRVNPVD NPPPVTELFS QEHAGSTQLL YDLSPCFRFG  360
FMAANLAILE ATLTDKSATN KVHVIDFDIG QGGQYVLLLH ALSARLNGMP ATVKITTVAD  420
NGGEDRLTMV RQNLSKVAKQ QGVVLEFNIV SQKLGELNRE SLGCEPDEPI AVNFAFKLYS  480
MPDESVSTDN PRDELLRRVK GLSPRVVTLV EQELNTNTAP FMARVKETCG YYGALLESMK  540
WTEGRDNSER VKAEEALSRK LINSVACEGR DRVERCEVFG KWRARMGMAG FELRPMSQNV  600
TEILKQRLSS GNNRVNSGFT VKEENGGVCF GWISRTLTVA SAWR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-154GRAS family protein