PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001279.1_g020.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 448aa    MW: 50483.2 Da    PI: 5.075
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001279.1_g020.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS313.93.6e-96644453374
                       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                                +lL+ecA+avs++d +++++lL+ l+elasp+gd  q+la+yf++AL  + ++s+ ++yk+l++ ++++++ +++ +    f+e
  Pav_sc0001279.1_g020.1.mk  64 RLLMECARAVSEKDSSKINHLLWMLNELASPYGDCEQKLASYFLQALFCKATDSGLRCYKTLTSVAEKSHSFDSARKLILKFQE 147
                                79************************************************************9999985554444444445*** PP

                       GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                                vsP+ +f+h++ N aIlea++ge+++HiiD++ + ++QWp+Ll+aLa+R++++p+l++T+v+  ++  k  ++e+g+r++kfA+
  Pav_sc0001279.1_g020.1.mk 148 VSPWTTFGHVASNGAILEALDGETKLHIIDISNTLCTQWPTLLEALATRNDETPHLKLTVVVT-ANIVKSVMKEIGQRMEKFAR 230
                                ***************************************************************.66799*************** PP

                       GRAS 171 elgvpfefnvl.vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse. 251
                                 +gvpfe+nv+   ++l +l+ e+L v+++Ea+aVn++ +l r+      +e+ r +v+++++sl+P+vv+vve+ead+ +s+ 
  Pav_sc0001279.1_g020.1.mk 231 LMGVPFEINVIsGLNNLGELTKEDLGVQEDEAIAVNCIGALRRIE-----VEE-RGAVIRMFQSLRPRVVTVVEEEADLfSSSv 308
                                **********95567*****************************7.....444.88********************99965546 PP

                       GRAS 252 ..sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerr........erhetlekWrerleeaGFk 325
                                  +F++ f e+l++y+  fd+le+++ ++s+er ++Ere  +r+iv v+ c + ++         er+e+ ++W+erl+ea F+
  Pav_sc0001279.1_g020.1.mk 309 nhDFVKCFEECLRFYTLYFDMLEESFFPTSNERLMLERE-CSRSIVRVLGCDHHDHDdkngggecERRERGSQWSERLKEA-FS 390
                                669************************************.89*********9887643334444489************98.** PP

                       GRAS 326 pvplsekaakqaklllrkvk.sdgyrve...ee..sgslvlgWkdrpLvsvSaWr 374
                                p+ +s+++++++k+ll+++  ++g  +    e+  +  ++l+Wk++p+v++S W+
  Pav_sc0001279.1_g020.1.mk 391 PIGFSDDVVDDVKALLKRYRsGWGLVLPpqgEDidQTGVYLTWKEEPVVWASIWK 445
                                ********************88998887555225477788**************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    
MDITLFSTNK EANFLQQYSN QIKINGLAAI DMQSTNQPQN SHTSTSRSSG SSEPCPAGTK  60
WASRLLMECA RAVSEKDSSK INHLLWMLNE LASPYGDCEQ KLASYFLQAL FCKATDSGLR  120
CYKTLTSVAE KSHSFDSARK LILKFQEVSP WTTFGHVASN GAILEALDGE TKLHIIDISN  180
TLCTQWPTLL EALATRNDET PHLKLTVVVT ANIVKSVMKE IGQRMEKFAR LMGVPFEINV  240
ISGLNNLGEL TKEDLGVQED EAIAVNCIGA LRRIEVEERG AVIRMFQSLR PRVVTVVEEE  300
ADLFSSSVNH DFVKCFEECL RFYTLYFDML EESFFPTSNE RLMLERECSR SIVRVLGCDH  360
HDHDDKNGGG ECERRERGSQ WSERLKEAFS PIGFSDDVVD DVKALLKRYR SGWGLVLPPQ  420
GEDIDQTGVY LTWKEEPVVW ASIWKPSN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-143GRAS family protein