PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001175.1_g260.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 742aa    MW: 83178.2 Da    PI: 6.8187
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001175.1_g260.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS313.35.5e-961875572374
                       GRAS   2 velLlecAeavssgdlelaqalLarlsel......aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseela 79 
                                +e L+++A++++s++l+laq +L rl+++      + p g+p+qR+a yf  AL++ l++s s      + + +s+++ ++++ 
  Pav_sc0001175.1_g260.1.mk 187 IEELIRAADCFDSDELQLAQGILDRLNQRlrssspSKPVGKPLQRAAVYFRDALQSILNGSDSA----AHNQLSSWSEIVQTIR 266
                                679*************************9876433345679*******************4444....45555666669***** PP

                       GRAS  80 alklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp......eg.ppslRiTgvgspesgske 156
                                a+k f  +sP++ fsh+t+Nqa+lea++g+  +H++Dfdi+ G+Q+++L+++La+++      ++ p  lRiT+v+++e   + 
  Pav_sc0001175.1_g260.1.mk 267 AYKGFCGISPVPMFSHFTTNQALLEALSGSAFIHVVDFDIGFGGQYASLMKELAEKAdvagrtSPvPQVLRITAVVPEE--YAG 348
                                *******************************************************99776544344559********66..999 PP

                       GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                e++ ++e+L++fA+ l+++f+ +++ ++++e++++++ ++  gE++aV l+  + r l    +++++++++L  +++lsP vvv
  Pav_sc0001175.1_g260.1.mk 349 ETRLVKENLSQFAQDLKIRFQVEFVPVRTFEMMSFKAVKFMDGEKTAVLLSPYILRRL----CSQNNISAFLGDMRRLSPSVVV 428
                                99***********************9*************************9999998....44444778************** PP

                       GRAS 241 vveqe..adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                +v+ +   d  ++sF + f+++le+ys++++sl+a ++++se  +k+E +ll+++i+ +v ++g++       +  Wre+++ a
  Pav_sc0001175.1_g260.1.mk 429 FVDADgmGDSATTSFRRNFVSSLEFYSVMLESLDAAAAAASEVVKKIETFLLRPKIQAAVEAAGRR-------VPPWREAFHGA 505
                                *****54455788***************************************************98.......99********* PP

                       GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                G+++v+ls++a  qa++ll kv+++g++v +++++lvl+W+dr+Lv++SaWr
  Pav_sc0001175.1_g260.1.mk 506 GMRAVELSQFADFQAQCLLGKVQVRGFHVAKRQAELVLCWHDRALVATSAWR 557
                                ***************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    
MRVPVSSPQT NPKLESCNNN NTNTNTNQTN RGLNFPANLN IQNLCYEPTS VLDLRHSPSP  60
VAEQKPAKIS AVSDVLSHPN HHDPLEWDEQ ALHNLDWDSI MRDLGLHDDS VPNLKTSIPQ  120
LNSTDSQISH LSDYPHPQPF DPTQLVHSDF NINLSESEVY SNPNFTNTTH NFYDHQPGNW  180
NVGFDFIEEL IRAADCFDSD ELQLAQGILD RLNQRLRSSS PSKPVGKPLQ RAAVYFRDAL  240
QSILNGSDSA AHNQLSSWSE IVQTIRAYKG FCGISPVPMF SHFTTNQALL EALSGSAFIH  300
VVDFDIGFGG QYASLMKELA EKADVAGRTS PVPQVLRITA VVPEEYAGET RLVKENLSQF  360
AQDLKIRFQV EFVPVRTFEM MSFKAVKFMD GEKTAVLLSP YILRRLCSQN NISAFLGDMR  420
RLSPSVVVFV DADGMGDSAT TSFRRNFVSS LEFYSVMLES LDAAAAAASE VVKKIETFLL  480
RPKIQAAVEA AGRRVPPWRE AFHGAGMRAV ELSQFADFQA QCLLGKVQVR GFHVAKRQAE  540
LVLCWHDRAL VATSAWRCGF PALFALLGDG ASRIQHSQRG RFTIAPLPSR FKHCSSNSMA  600
IERKDRNAQE KWLLYWAAYG SFSLVEIFSD KLISWCPMYY HLKFAFLVWL QLPSVDGAKQ  660
LYTNHLRPFF LKHQTRVDRV LGLTYGELHK LISAHQAEIE YARAVVMKIL GSDPRPNSDV  720
PRQNAIEGQA RIAPVSESDH ED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.11e-167GRAS family protein