PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0001080.1_g690.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 642aa    MW: 71330.9 Da    PI: 6.5051
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0001080.1_g690.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS440.99.3e-1352776411374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalk 82 
                                lv+lLl+cAeav+++d+ la+++L +l+  ++p gd+mqR+a++fteAL+arla   +++  ++a +p +  + ns e l++++
  Pav_sc0001080.1_g690.1.mk 277 LVHLLLACAEAVAKEDFMLARKYLHHLNRVVTPLGDSMQRVASCFTEALSARLAAtlTTNPAASAPKPFSPFPPNSLEILKIYQ 360
                                68****************************************************943333444444444444567********* PP

                       GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLa 166
                                + ++++P++kf+h+taNqaI ea+e+eervH+iD+di qG QWpa++qaLa+Rp+g+p lRiTgvg+      e+++etg+ L+
  Pav_sc0001080.1_g690.1.mk 361 IVYQACPYIKFAHFTANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGGAPFLRITGVGP----CIEAVKETGRCLT 440
                                *******************************************************************....************* PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                ++A +l+vpfef++ v ++ledl++++++ + gEalaVn v +lhr++    +l     +vL ++++  P++v++veqea+hn+
  Pav_sc0001080.1_g690.1.mk 441 ELALSLHVPFEFHA-VGEQLEDLKPHMFNRRIGEALAVNTVNRLHRVP--GNCLG----NVLAMIRDQAPNIVTLVEQEASHNG 517
                                **************.7*******************************9..44444....5************************ PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + Fl rfleal+yysa+fdsl+a++p++s +r+kvE+ ++++ei+n+vacegaer+erhe+lekWr+ +e+ GFk+v+ls +a+
  Pav_sc0001080.1_g690.1.mk 518 PYFLGRFLEALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRKVMESKGFKSVALSANAV 601
                                ************************************************************************************ PP

                       GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +q k ll  ++ dgyr+ e++g+l+lgW+dr+++++SaWr
  Pav_sc0001080.1_g690.1.mk 602 TQSKILLGLYSCDGYRMTEDKGCLLLGWQDRSIMAASAWR 641
                                ***************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    
MMMNSLCGSI GSIKSEISCT SDLKPPSPNE STTMSESKKT TTPPSSEMEQ SSLTPPSLNF  60
PSLKFELEGD VEVQSPDHSI WESLFSEQFD TDFMVLSPVP NNMPDSPQPG ASLSAAHNNY  120
NYNYAQSMQG QSLSGCSPPR FSPHLGAFSS THNPKGKGLS PLRRVFNSPV NQYMQPADQN  180
MQFSRSVSET SLVTAGNSQM TQESRASAYQ QMGSNCGAPL SQQLQQERQQ EKQQQQQPLM  240
HPIKHQHHQP QLHHNLNYMA PNLPMAPEQE QDSGLQLVHL LLACAEAVAK EDFMLARKYL  300
HHLNRVVTPL GDSMQRVASC FTEALSARLA ATLTTNPAAS APKPFSPFPP NSLEILKIYQ  360
IVYQACPYIK FAHFTANQAI FEAFESEERV HVIDLDILQG YQWPAFMQAL AARPGGAPFL  420
RITGVGPCIE AVKETGRCLT ELALSLHVPF EFHAVGEQLE DLKPHMFNRR IGEALAVNTV  480
NRLHRVPGNC LGNVLAMIRD QAPNIVTLVE QEASHNGPYF LGRFLEALHY YSAIFDSLDA  540
TFPPDSAQRA KVEQYIFAPE IRNIVACEGA ERTERHERLE KWRKVMESKG FKSVALSANA  600
VTQSKILLGL YSCDGYRMTE DKGCLLLGWQ DRSIMAASAW RC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-97GRAS family protein