PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000704.1_g110.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 438aa    MW: 48239 Da    PI: 5.5317
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000704.1_g110.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.98.2e-114974171334
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                lv+lL++cAe v+ gdl+la +l++++++l  + ++   + ++a yf  AL++r+++      ++  +s        e+   ++
  Pav_sc0000704.1_g110.1.mk  97 LVHLLVTCAESVQRGDLALAGSLIENMQTLltRVNTSCGIGKVAGYFIDALSRRIFS------HQGVAS------AHENELLYH 168
                                68***************************954444446899***************9......222222......334556789 PP

                       GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLa 166
                                +f+e++P+lkf+h+taNqaIlea++g+++vH+iDf++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa
  Pav_sc0000704.1_g110.1.mk 169 YFYEACPYLKFAHFTANQAILEAFQGHDCVHVIDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGLRLA 252
                                9*********************************************************************************** PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                ++A++++v+f f+ ++a+rled+++++L+v+p+Ea+aVn+++qlhrll ++ + +s+++ +L  +++l+Pk+v+vveqeadhn+
  Pav_sc0000704.1_g110.1.mk 253 ELARSVNVRFAFRGVAASRLEDVKPWMLQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLGWIRNLNPKIVTVVEQEADHNK 336
                                ************************************************************************************ PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + Fl+rf+eal+yys++fdslea    + + ++ + +++++rei+nvv+cega+r+erhe l+kWr+rl++aGF+p++l+++a 
  Pav_sc0000704.1_g110.1.mk 337 TGFLDRFTEALYYYSTMFDSLEAC---AMQPEKALAEMYIQREICNVVCCEGAARVERHEPLGKWRARLGQAGFRPLHLGSNAF 417
                                *********************999...467777888899*****************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    
MSAVISVLHY TSSSLLLASD AVLYNPSDLA TWVDSLLSEF NHQPLISLPS DLDFPDAIIN  60
PTDLPNDTWT EPLPPPQQQQ HQLTVVTAME EDSGIRLVHL LVTCAESVQR GDLALAGSLI  120
ENMQTLLTRV NTSCGIGKVA GYFIDALSRR IFSHQGVASA HENELLYHYF YEACPYLKFA  180
HFTANQAILE AFQGHDCVHV IDFNLMHGLQ WPALIQALAL RPGGPPLLRL TGIGPPSPDG  240
RDSLREIGLR LAELARSVNV RFAFRGVAAS RLEDVKPWML QVSPKEAVAV NSIMQLHRLL  300
GSDPNRNSPI EMMLGWIRNL NPKIVTVVEQ EADHNKTGFL DRFTEALYYY STMFDSLEAC  360
AMQPEKALAE MYIQREICNV VCCEGAARVE RHEPLGKWRA RLGQAGFRPL HLGSNAFGSS  420
GETGAVGEVE GSAGTSRV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-106GRAS family protein