PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000704.1_g100.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 142aa    MW: 16061.4 Da    PI: 9.2993
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000704.1_g100.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS35.91e-11136339374
                       GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +ll  ++ +gyrvee++g+l+lgW++rpL+++SaW+
  Pav_sc0000704.1_g100.1.mk   1 MLLTLFSAEGYRVEENDGCLTLGWHSRPLIAASAWQ 36 
                                69999******************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    
MLLTLFSAEG YRVEENDGCL TLGWHSRPLI AASAWQVMPT AEATTANQPE NHVHVMDGLD  60
RRQSTQGKRG CGRDPWCPPR LILQRKKTGK KMNKEMEIGK GKHTGIEMDG YMNKTNRTGI  120
ERETPLAIWH SLTVQFLDNK SL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.12e-14GRAS family protein