PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000661.1_g450.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 405aa    MW: 45740.9 Da    PI: 6.9417
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000661.1_g450.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.31.5e-100294041374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l++lL++cA++ +sgdl+la+++L+++s las +gd+mqRlaa f+ ALa rl+++++++ kal+  ++++k + +   a+ +f
  Pav_sc0000661.1_g450.1.mk  29 LIQLLIKCANHTASGDLNLADECLCQISRLASLHGDSMQRLAAQFASALAVRLVKNWPGIQKALNYDTKRPKLELDP--ARVIF 110
                                689******************************************************************98776666..5558* PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                                 +++P+l f++ +  +++l+a++ e+ +Hi+D++   +  W++Llq++a+ p+gpp+l+iT v+s    +k  le++g +L k 
  Pav_sc0000661.1_g450.1.mk 111 TKAFPYLGFAYAIIARTLLQAMSAERVIHIVDLGSADPKLWAPLLQSFAALPDGPPHLKITCVHS----NKAVLEKLGLKLVKE 190
                                *****************************************************************....99************* PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll...............desvsleserdevLklvkslsPk 237
                                Ae+l++pf++n+l   +l +l+ ++L+v+ gEal   ++l+lh ll               + +v+  ++  e+L +v+s+ Pk
  Pav_sc0000661.1_g450.1.mk 191 AEALDMPFQYNPL-NVSLRELTKDMLKVRLGEALGFVSILNLHVLLaqddqadaqfrpkksNIDVKDCKQMGEFLGMVRSMYPK 273
                                ************5.889*****************************************966445555558899*********** PP

                       GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleak...lpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                                vv +veqea hns+ +++rf+e l+yysa+fdslea+   l++ seer ++E++ +grei+n+va eg er+erhe+++ W  r
  Pav_sc0000661.1_g450.1.mk 274 VVLLVEQEAHHNSNHLVDRFIEGLHYYSAMFDSLEASfggLSSSSEERFVLEEM-FGREIENIVAWEGVEREERHERYAWWMVR 356
                                ***********************************9933344555999999999.***************************** PP

                       GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                + e+GFkpv+l  + +++ k        +gy++ +++ sl+++W++rpL++vSaW+
  Pav_sc0000661.1_g450.1.mk 357 FCEVGFKPVRLWLDSMEDSK--------KGYKIISQRTSLMICWNERPLYAVSAWT 404
                                ***********999998875........79*************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    
MYPSSSSSSL SSSSPPLEAL KPEERGLHLI QLLIKCANHT ASGDLNLADE CLCQISRLAS  60
LHGDSMQRLA AQFASALAVR LVKNWPGIQK ALNYDTKRPK LELDPARVIF TKAFPYLGFA  120
YAIIARTLLQ AMSAERVIHI VDLGSADPKL WAPLLQSFAA LPDGPPHLKI TCVHSNKAVL  180
EKLGLKLVKE AEALDMPFQY NPLNVSLREL TKDMLKVRLG EALGFVSILN LHVLLAQDDQ  240
ADAQFRPKKS NIDVKDCKQM GEFLGMVRSM YPKVVLLVEQ EAHHNSNHLV DRFIEGLHYY  300
SAMFDSLEAS FGGLSSSSEE RFVLEEMFGR EIENIVAWEG VEREERHERY AWWMVRFCEV  360
GFKPVRLWLD SMEDSKKGYK IISQRTSLMI CWNERPLYAV SAWTC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-95GRAS family protein