PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000622.1_g450.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 640aa    MW: 71298.1 Da    PI: 5.7721
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000622.1_g450.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS439.13.1e-1342005691373
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l+e+L++cA+av+++d++ +++l+ +l++++s +g+p+qRl ay++e+L arla+s+s++++al+++e +   s+e l++++++
  Pav_sc0000622.1_g450.1.mk 200 LKEVLFACAKAVANSDKSTTEWLMLNLRKMVSVSGEPIQRLGAYILEGLVARLASSGSSICAALRCKEPA---SAELLSYMHML 280
                                5789*****************************************************************9...9********** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLa 166
                                +e++P++kf+++ aN aI ea++ e+rvHiiDf++ qG QW++L+qaLa+Rp+gpp++RiTg+++++s   +   l  +g+rL+
  Pav_sc0000622.1_g450.1.mk 281 YEICPYFKFGYMSANGAIAEAMKDESRVHIIDFQVAQGSQWITLIQALATRPGGPPQIRITGIDDSTSAyaRGGGLGLVGQRLS 364
                                *****************************************************************998899999********** PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                ++Ae+++vpfef++ +  + ++++le+++v+pgEa+aVn++++lh+++desvs +++rd++L+lvkslsPkvv++veqe+++n+
  Pav_sc0000622.1_g450.1.mk 365 RLAESCKVPFEFHA-AGISASEVQLEDIEVRPGEAIAVNFAFMLHHMPDESVSCQNHRDRLLRLVKSLSPKVVTLVEQESNTNT 447
                                **************.7889***************************************************************** PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                ++Fl rf+e+l+y+ a+fds+++ lpre++eri++E+++l+reivn++aceg er+er e l+kW++r+ +aGF+p+pls+ ++
  Pav_sc0000622.1_g450.1.mk 448 APFLPRFAETLSYFRAVFDSIDVALPREHKERINIEQHCLAREIVNIIACEGMERVERYELLSKWKSRFIMAGFSPYPLSSLVN 531
                                ************************************************************************************ PP

                       GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                 ++k+ll+ ++++ y++ee++g+l+lgW+++ Lv+ +aW
  Pav_sc0000622.1_g450.1.mk 532 GTIKTLLQSYSEK-YTLEERDGALYLGWMNQVLVASCAW 569
                                ***********65.************************* PP

Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    
MNSEEAKEKT KAEGCNNHIP FICQKPNWVF TKFLESQKHI IPNVSHGCGE QPVEEPESYS  60
WPPIYSVDHQ ASSDEVIQRT QLSVQNLAPY CTHESSSGTS TYHPVHSSPS SIGFSANGSP  120
TSHPDLQNYQ SCGSPVNQSC LSNDTDDLGH KMRELESVLL GNDLDAFDMY AITDELGPNQ  180
LSSEAENWEQ MMEMISRGDL KEVLFACAKA VANSDKSTTE WLMLNLRKMV SVSGEPIQRL  240
GAYILEGLVA RLASSGSSIC AALRCKEPAS AELLSYMHML YEICPYFKFG YMSANGAIAE  300
AMKDESRVHI IDFQVAQGSQ WITLIQALAT RPGGPPQIRI TGIDDSTSAY ARGGGLGLVG  360
QRLSRLAESC KVPFEFHAAG ISASEVQLED IEVRPGEAIA VNFAFMLHHM PDESVSCQNH  420
RDRLLRLVKS LSPKVVTLVE QESNTNTAPF LPRFAETLSY FRAVFDSIDV ALPREHKERI  480
NIEQHCLARE IVNIIACEGM ERVERYELLS KWKSRFIMAG FSPYPLSSLV NGTIKTLLQS  540
YSEKYTLEER DGALYLGWMN QVLVASCAWS LTKLRDSLQL ATAAGYRCAI EPQQLVSIYC  600
ASWMPHISLF GHLLYHLSVL LKPFKRFYGV MHPQDPFNPV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.10.0GRAS family protein