PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000562.1_g070.1.br
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 98aa    MW: 11254.9 Da    PI: 4.8629
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000562.1_g070.1.brgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS52.68.7e-171797153234
                       GRAS 153 gskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                                ++ + le +g+rL+ + e++++ +ef+  v     d++ ++L+v+p EalaV++ lqlh+++desv+ +++rde+L+++ksl
  Pav_sc0000562.1_g070.1.br  17 DHGDGLEVVGRRLKAIFEKFNILVEFHG-VLVFAPDVTQDMLDVRPVEALAVKFPLQLHHTPDESVDENNPRDELLRMIKSL 97 
                                47899***********************.67789999*******************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    
MQFESFRDFL SGITLHDHGD GLEVVGRRLK AIFEKFNILV EFHGVLVFAP DVTQDMLDVR  60
PVEALAVKFP LQLHHTPDES VDENNPRDEL LRMIKSLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.12e-19GRAS family protein