PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000464.1_g350.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 531aa    MW: 58045.4 Da    PI: 4.902
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000464.1_g350.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.91.7e-1371625221374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                lv++L++cA+av++++l+la+al++++  la++++ +m+++a+yf+eALa+r++r        + p+++ +++ s+ l++   f
  Pav_sc0000464.1_g350.1.mk 162 LVHTLVACAKAVQQENLKLADALVKHVGLLAASQAGAMRKVATYFAEALARRIYR--------IYPQDSLDSSYSDILQM--HF 235
                                689****************************************************........44555554445555444..5* PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                                +e++P+lkf+h+taNqaIlea+++++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++
  Pav_sc0000464.1_g350.1.mk 236 YETCPYLKFAHFTANQAILEAFATASRVHVIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQL 319
                                ************************************************************************************ PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                Ae++gv+fef+ +va++l+dle++ L+++p   E++aVn+ ++lh ll++++++e+    vL+ +k ++Pk+v++veqea+hn+
  Pav_sc0000464.1_g350.1.mk 320 AETIGVEFEFRGFVANSLADLEPSILEIRPpdVETVAVNSCFELHPLLARPGAVEK----VLSSIKAMKPKIVTIVEQEANHNG 399
                                ******************************999***********************....************************ PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + Fl+rf eal+yys lfdsle +  +  +++ ++++++lgr+i+nvvaceg++r+erhetl +Wr r+++aGF  v+l+++a 
  Pav_sc0000464.1_g350.1.mk 400 PIFLDRFNEALHYYSNLFDSLEGS--SGPSQDLVMSEVYLGRQICNVVACEGQDRVERHETLTQWRGRMDSAGFDLVHLGSNAF 481
                                *********************999..566999**************************************************** PP

                       GRAS 335 kqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                kqa++ll+ ++ +dgyrvee++gsl+lgW++rpL+++SaW+
  Pav_sc0000464.1_g350.1.mk 482 KQASMLLALFAgGDGYRVEENNGSLMLGWHTRPLIATSAWQ 522
                                ****************************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    
MAEVAEKLEQ LEMVMGSAQE DGISQLSDTV HYNPSDLSGW VQSMLSEFNT VDGSAIDDPL  60
FVAADSSSIT SIHFSNSHQI ENPASRIFHD DSEYDLRAIP GVAAYPQTHL DSEAESRRKR  120
LKTSIGSNSI GSNSGVVADS GFVSDPARPL VLVDSQETGV RLVHTLVACA KAVQQENLKL  180
ADALVKHVGL LAASQAGAMR KVATYFAEAL ARRIYRIYPQ DSLDSSYSDI LQMHFYETCP  240
YLKFAHFTAN QAILEAFATA SRVHVIDFGL KQGMQWPALM QALALRPGGP PAFRLTGIGP  300
PQPDNTDALQ QVGWKLAQLA ETIGVEFEFR GFVANSLADL EPSILEIRPP DVETVAVNSC  360
FELHPLLARP GAVEKVLSSI KAMKPKIVTI VEQEANHNGP IFLDRFNEAL HYYSNLFDSL  420
EGSSGPSQDL VMSEVYLGRQ ICNVVACEGQ DRVERHETLT QWRGRMDSAG FDLVHLGSNA  480
FKQASMLLAL FAGGDGYRVE ENNGSLMLGW HTRPLIATSA WQMASSTEST R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0GRAS family protein