PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000405.1_g450.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 445aa    MW: 49338.2 Da    PI: 5.4439
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000405.1_g450.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.36.4e-90464312373
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.. 83 
                                ++lLl+cA a++s+d +laq++++ l++ as+ gdp+qRl++ +++AL +r ++ +++ ++ ++ s++s++  ++ +++++l  
  Pav_sc0000405.1_g450.1.mk  46 EKLLLHCASALESNDVTLAQQVMWVLNNVASSVGDPNQRLTSWILRALISRASKVCPTPMN-FNGSTSSSTIPTRLMSVTELag 128
                                689***************************************************8777775.5555555445666666666689 PP

                       GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetger 164
                                ++++ P+++f++ + N+aI +a++g+ +vHi+Df+i++++QWp+L++aLa+Rpegpp lR+T+ +   ++    + + ee+g r
  Pav_sc0000405.1_g450.1.mk 129 YVDLIPWHRFGYCASNSAIFKAIQGCPKVHILDFSITHCMQWPTLIDALAKRPEGPPLLRVTVPNWRPQVpplLNVSSEEVGLR 212
                                **************************************************************998755558899999******* PP

                       GRAS 165 LakfAeelgvpfefnvlvak.rledl.....eleeLrvkpgEalaVnlvlqlhrll.........desvsleserdevLklvks 233
                                L +f +  +vpfefnv+  + +le l     +++ L+++ +E+l+Vn++  l +l          +   +  s r+++L++++s
  Pav_sc0000405.1_g450.1.mk 213 LGNFSRFRDVPFEFNVIENSsSLELLlstqlNPSPLDLRDDEVLVVNCQNWLRYLSddprggspsH---QDGSMRNTFLNMIRS 293
                                ****************944436666555555899999999***************94444442222...3334777******** PP

                       GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                                l+P+++vvv++++d++++s+  r++ +++y++  fdsle+ lp++s +r+ +E   +g +i+n++  eg +r+er et    ++
  Pav_sc0000405.1_g450.1.mk 294 LNPRIIVVVDEDSDLSAPSLSSRITTCFNYMWIPFDSLETFLPKDSAQRMDYESD-VGHKIENIIGFEGHQRIERLETGVAMSQ 376
                                *******************************************************.**************************** PP

                       GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                r++++GF ++p+ e+++k++k ll +++  g+ ++ e++ lvl+Wk+++ v+++aW
  Pav_sc0000405.1_g450.1.mk 377 RIRNVGFLSAPFCEETVKEVKGLLDEHA-SGWGMKREEDMLVLTWKGHNSVFATAW 431
                                ****************************.889999999****************** PP

Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    
MKTEVRGSTT SISLQNPTTI FNTSQGPSLT GALKGCLGSL DGACIEKLLL HCASALESND  60
VTLAQQVMWV LNNVASSVGD PNQRLTSWIL RALISRASKV CPTPMNFNGS TSSSTIPTRL  120
MSVTELAGYV DLIPWHRFGY CASNSAIFKA IQGCPKVHIL DFSITHCMQW PTLIDALAKR  180
PEGPPLLRVT VPNWRPQVPP LLNVSSEEVG LRLGNFSRFR DVPFEFNVIE NSSSLELLLS  240
TQLNPSPLDL RDDEVLVVNC QNWLRYLSDD PRGGSPSHQD GSMRNTFLNM IRSLNPRIIV  300
VVDEDSDLSA PSLSSRITTC FNYMWIPFDS LETFLPKDSA QRMDYESDVG HKIENIIGFE  360
GHQRIERLET GVAMSQRIRN VGFLSAPFCE ETVKEVKGLL DEHASGWGMK REEDMLVLTW  420
KGHNSVFATA WVANGPNPNG LLMED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-120GRAS family protein