PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000398.1_g400.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 534aa    MW: 59215.3 Da    PI: 5.8097
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000398.1_g400.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS220.49.1e-682144361225
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l+elL++cA a+s+++    ++l+++ +  +s +g+p+qRl ay++e+L ar   s+ ++y+al+++e +   s++ l++++++
  Pav_sc0000398.1_g400.1.mk 214 LKELLIACAGALSDNNIDSFDKLIEKARGAVSISGEPIQRLGAYLVEGLVARKEASGANIYRALRCREPE---SDDLLSYMQIL 294
                                5799*****************************************************************9...9********** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLa 166
                                +e++P+lkf++++aN aI ea  +e+r+HiiDf+i qG QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++g+rL+
  Pav_sc0000398.1_g400.1.mk 295 YEICPYLKFGYMAANGAIAEACRNEDRIHIIDFQIAQGSQWVTLLQALAARPGGAPHVRITGIDDPLSQyaRGDGLEAVGRRLK 378
                                *****************************************************************9998999************ PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserd 225
                                 + e++++p+ef+  v     d++ ++L+v+pgEalaVn+ lqlh+++desv+ +++rd
  Pav_sc0000398.1_g400.1.mk 379 AISEKFNIPVEFHG-VPVFAPDVTQDMLDVRPGEALAVNFPLQLHHTPDESVDENNPRD 436
                                **************.6888999*******************************999887 PP

2GRAS103.82.5e-32439533278373
                       GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                                +++eri+vE+++l+r+ vnv+aceg+er+erhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lg
  Pav_sc0000398.1_g400.1.mk 439 NNKERINVEQHCLARDMVNVIACEGKERVERHELFGKWKSRLTMAGFQQYPLSSYVNSVIRSLLRCYS-EHYTLVERDGAMLLG 521
                                689*************************************************************9999.66************* PP

                       GRAS 362 WkdrpLvsvSaW 373
                                Wkdr+L+s+SaW
  Pav_sc0000398.1_g400.1.mk 522 WKDRNLISASAW 533
                                ************ PP

Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    
MDSHQHFGFG VTGAGFSYTA PHSTVPSLPT RLLGSLKFDI GNSPNSPFST HFDSDTLTTL  60
SDGQEQHSST ENLSGASPSC NSSFETNSYI HQLSFSPSVV CRRDSLQLYS GRTSLLQDAN  120
SSQNIKHALQ ELESTLMGPD NEEEEVTTTN TSFGESSKLQ TQRSTSWIQE HQGSPVVQRQ  180
TSFVSRQRQL CEFQIEKRHK IIDEGSLGLP AGNLKELLIA CAGALSDNNI DSFDKLIEKA  240
RGAVSISGEP IQRLGAYLVE GLVARKEASG ANIYRALRCR EPESDDLLSY MQILYEICPY  300
LKFGYMAANG AIAEACRNED RIHIIDFQIA QGSQWVTLLQ ALAARPGGAP HVRITGIDDP  360
LSQYARGDGL EAVGRRLKAI SEKFNIPVEF HGVPVFAPDV TQDMLDVRPG EALAVNFPLQ  420
LHHTPDESVD ENNPRDGLNN KERINVEQHC LARDMVNVIA CEGKERVERH ELFGKWKSRL  480
TMAGFQQYPL SSYVNSVIRS LLRCYSEHYT LVERDGAMLL GWKDRNLISA SAWH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.11e-137GRAS family protein