PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000355.1_g250.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 697aa    MW: 76786.3 Da    PI: 5.4515
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000355.1_g250.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.79.1e-1313146821374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                lv+lL++c+ea+  ++ +++++++a+l elasp+g+++ Rl+ay+teALa r++r +++++++ pp+e + +  +++  al+l+
  Pav_sc0000355.1_g250.1.mk 314 LVSLLTACVEAIGLKNIAAINHFIAKLGELASPRGTTISRLTAYYTEALALRVTRLWPHVFQITPPREFD-RGDDDSGIALRLL 396
                                6899*****************************************************************8.4567777899*** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                                ++vsPi+kf h+t N+ +l+a+eg++rvHiiDfdi+qGlQWp+L+q+LasR+++p ++RiTg+g+    sk+el+etg+rLa f
  Pav_sc0000355.1_g250.1.mk 397 NQVSPIPKFLHFTSNEILLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLASRANPPSHIRITGIGE----SKQELNETGDRLAGF 476
                                *****************************************************************....*************** PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                                A +l++pfef++ v++rled++l++L+vk++E++aVn+v+qlh++l + +  +   +++L l++s++P++v ++eqea+hn+++
  Pav_sc0000355.1_g250.1.mk 477 AGALNLPFEFHP-VVDRLEDVRLWMLHVKEQESVAVNCVFQLHKTLYDGTGGA--LRDFLGLIRSTNPTIVLMAEQEAEHNEPR 557
                                ************.7********************************6655444..489************************** PP

                       GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                                + +r++++l++ysa+fd ++++lp es++rikvE++ ++rei+nv+aceg++r erhe++ekWr+ +e+ GF+ + ++e+++ q
  Pav_sc0000355.1_g250.1.mk 558 LETRVSNSLKHYSAIFDLISSSLPLESQARIKVEEM-FAREIRNVIACEGSDRLERHESFEKWRKLMEQGGFRCMGITEREMLQ 640
                                ************************************.*********************************************** PP

                       GRAS 337 aklllrkvksdgyrveee....sgslvlgWkdrpLvsvSaWr 374
                                 + ll++++++ y+v+++     ++l+lgW+d+pL++vSaW+
  Pav_sc0000355.1_g250.1.mk 641 SQFLLKMYAGENYNVKKQgqdgAAALTLGWMDQPLYTVSAWT 682
                                *********999****77665567788**************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    
MLAGCSSSTL LSPRHRLRSE AAAQLQACHF QLPAMSTQRL DLPCSFPRKD TSRSQTIRPV  60
GLSVEKSIDS KTSSCSLKQS IRLPPLATSG PVTSAAQTAA FVEARKEVND QFWEKKRGKS  120
LKRFAEQGSV DDDESCINRA KRKKGCFDNG KGDEGGDGLS LGQLGAGNFW FQPDFHVPRS  180
VQSITTGLDP PPQLPFSLTC SGDEERVCYV PAEAISQPLP LSNNPWLDSI VTEITDLGEK  240
DAETRRGLGR EASAAASSAS SDSQSLGLRL NESASEHEVG NGSRDPYIPH GGAGVEAEDD  300
DDDESEGEHQ GFELVSLLTA CVEAIGLKNI AAINHFIAKL GELASPRGTT ISRLTAYYTE  360
ALALRVTRLW PHVFQITPPR EFDRGDDDSG IALRLLNQVS PIPKFLHFTS NEILLRAFEG  420
KDRVHIIDFD IKQGLQWPSL FQSLASRANP PSHIRITGIG ESKQELNETG DRLAGFAGAL  480
NLPFEFHPVV DRLEDVRLWM LHVKEQESVA VNCVFQLHKT LYDGTGGALR DFLGLIRSTN  540
PTIVLMAEQE AEHNEPRLET RVSNSLKHYS AIFDLISSSL PLESQARIKV EEMFAREIRN  600
VIACEGSDRL ERHESFEKWR KLMEQGGFRC MGITEREMLQ SQFLLKMYAG ENYNVKKQGQ  660
DGAAALTLGW MDQPLYTVSA WTPVDVAGSS SSFSQPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein