PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000261.1_g150.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 480aa    MW: 52716.7 Da    PI: 6.1087
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000261.1_g150.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3572.9e-109203841367
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalk 82 
                                lv+lL++cAeav+ +d++ a+alL++l+ +a   g+++qR+a++f+++La+rla  ++  +  +  +p ++++   +++  al+
  Pav_sc0000261.1_g150.1.mk  20 LVQLLIACAEAVACRDKSHASALLSELRANALVFGSSFQRVASCFVQGLANRLALVQPLGAVGFigSPMNAKDFALDKKEEALR 103
                                689**************************************************9955544434413444444444999999*** PP

                       GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleet 161
                                l +e++P ++f+h++aN+ Ilea+ege+ vH++D++++    +G QW  L+++La+R+++pp +lRiTgvg       ++l+ +
  Pav_sc0000261.1_g150.1.mk 104 LVYEICPHIQFGHFVANSSILEAFEGESFVHVVDLGMTlglpHGDQWRGLIESLATRAGQPPsRLRITGVGL----FGDRLQII 183
                                **********************************99873333667*************888879********....99****** PP

                       GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                                g+ L+ +A++lg+++ef+v v+++le+l++e++++  gE+l+Vn++lqlh +++es    +   +vL++v +lsPk++v+veq+
  Pav_sc0000261.1_g150.1.mk 184 GDELEAYADSLGINLEFSV-VESNLENLRPEDIKLLDGEVLVVNSILQLHCVVKESRGALN---SVLQMVHELSPKILVLVEQD 263
                                ******************9.7********************************88877777...8******************* PP

                       GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329
                                ++hn++ Fl rf+eal+yysa+fdsl+a lp+ +  r+k+E++++++ei+n+++ceg +r+erhe++ +Wr+r+++aGF+++p+
  Pav_sc0000261.1_g150.1.mk 264 SSHNGPFFLGRFMEALHYYSAIFDSLDAMLPKYDTRRAKMEQFYFAEEIKNIISCEGPARVERHERVDQWRRRMSRAGFQAAPI 347
                                ***********************************************************************************9 PP

                       GRAS 330 sekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                                +  +  +ak  l k+k  +gy++ ee+g+lvlgWk++p+
  Pav_sc0000261.1_g150.1.mk 348 K--MLVNAKQWLGKIKvCEGYTILEEKGCLVLGWKSKPI 384
                                7..5678999******99*****************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    
MTNAEGNGAE EDGTADGMRL VQLLIACAEA VACRDKSHAS ALLSELRANA LVFGSSFQRV  60
ASCFVQGLAN RLALVQPLGA VGFIGSPMNA KDFALDKKEE ALRLVYEICP HIQFGHFVAN  120
SSILEAFEGE SFVHVVDLGM TLGLPHGDQW RGLIESLATR AGQPPSRLRI TGVGLFGDRL  180
QIIGDELEAY ADSLGINLEF SVVESNLENL RPEDIKLLDG EVLVVNSILQ LHCVVKESRG  240
ALNSVLQMVH ELSPKILVLV EQDSSHNGPF FLGRFMEALH YYSAIFDSLD AMLPKYDTRR  300
AKMEQFYFAE EIKNIISCEG PARVERHERV DQWRRRMSRA GFQAAPIKML VNAKQWLGKI  360
KVCEGYTILE EKGCLVLGWK SKPIEHYKDL KGKSFFPKLI DYIVSGPVVC MAWEGVGVVA  420
AARKLIGSTN PLQAEPGTIR GDLAVQTGRN VVHGSDSPEN GKREIVDASP RTMVEGVIVT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-77GRAS family protein