PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000221.1_g210.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 633aa    MW: 69942.8 Da    PI: 5.4298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000221.1_g210.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.85.2e-1392656241374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                lv+ L++cAeav++++l+la+al++++  la +++ +m+++a+yf+eALa+r++r    +y    p++    ++s + + +  f
  Pav_sc0000221.1_g210.1.mk 265 LVHGLMACAEAVQKNNLNLAKALVTQIGYLAISQAGAMRKVATYFAEALAQRIFR----VY----PQSPI--DHSFSDMLQMHF 338
                                6899***************************************************....44....33333..23444444556* PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                                +e++P+lkf+h+taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s++++ l+e+g++La++
  Pav_sc0000221.1_g210.1.mk 339 YETCPYLKFAHFTANQAILEALQGKTRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPASDNSDHLQEVGWKLAQL 422
                                ************************************************************************************ PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                Ae+++v+fe++ +va++l+dl+ ++L+++p   E++aVn+v++lh+ll++++++e+    vL++vk+++P++v+vveqea+hn+
  Pav_sc0000221.1_g210.1.mk 423 AETIHVEFEYRGFVANSLADLDASMLELRPseVESVAVNSVFELHKLLARPGAIEK----VLSVVKQMKPEIVTVVEQEANHNG 502
                                ******************************88899*********************....************************ PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + F++rf e+l+yys+lfdsle ++   +++++ +++ +lg++i+nvvaceg +r+erhetl +Wr rl++aGF pv+l+++a 
  Pav_sc0000221.1_g210.1.mk 503 PVFMDRFNESLHYYSTLFDSLEGSV---NSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSAGFVPVHLGSNAF 583
                                ************************7...88889999999********************************************* PP

                       GRAS 335 kqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  Pav_sc0000221.1_g210.1.mk 584 KQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWK 624
                                ****************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    
MKREHQSYRQ YTYPDPSSMA STSAGDCGKA SNKMWEEEAQ RIDGGMDELL AVLGYKVRSS  60
DMADVAQKLE QLEEFMGSVQ EDGLSQLASD TVHYNPSDLS TWLESMISEI NPPPNFDPLM  120
AAAAAPLPNQ QQQVQLGDDS FLAPAESSTI TSIDFRDQQM SKSLSPPPPQ TQNHHPHHQV  180
VFDDCNSSSN YYDLKATMFT QTHHDSSSRE AKRLKPSSGS SASDLVFNRR TASSLPQPQP  240
LSIPTTESST RPALLVDSQE NGVRLVHGLM ACAEAVQKNN LNLAKALVTQ IGYLAISQAG  300
AMRKVATYFA EALAQRIFRV YPQSPIDHSF SDMLQMHFYE TCPYLKFAHF TANQAILEAL  360
QGKTRVHVID FSMNQGMQWP ALMQALALRP GGPPAFRLTG IGPPASDNSD HLQEVGWKLA  420
QLAETIHVEF EYRGFVANSL ADLDASMLEL RPSEVESVAV NSVFELHKLL ARPGAIEKVL  480
SVVKQMKPEI VTVVEQEANH NGPVFMDRFN ESLHYYSTLF DSLEGSVNSQ DKAMSELYLG  540
KQICNVVACE GVDRVERHET LTQWRTRLDS AGFVPVHLGS NAFKQASMLL ALFAGGDGYR  600
VEENNGCLML GWHTRPLIAT SAWKPGCDSV MAH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein