PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000206.1_g120.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 474aa    MW: 53996.1 Da    PI: 6.8011
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000206.1_g120.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS385.27.7e-118774731373
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal... 81 
                                +++lL++cAe +s+ d++ a++l++ ls  +sp gd+++Rl+  f++AL+ rl++  ++ ++al++ +t+  +ss++   l   
  Pav_sc0000206.1_g120.1.mk  77 MRQLLITCAELISQLDFSSARRLISLLSSKSSPFGDSTERLTYQFVKALSLRLNNPNPSSSAALTTAATAAASSSSNYLLLeee 160
                                589****************************************************99999988877777655533333333455 PP

                       GRAS  82 .............klfsevsPilkfshltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRp........egppslR 143
                                              +++ ++P+++fshltaNqaIlea++++ + +Hi+Dfdi++G+QWp+L+qaLa+R+        ++pp+lR
  Pav_sc0000206.1_g120.1.mk 161 ddnnneealhscyLTLNRITPFIRFSHLTANQAILEAIDSShHSIHILDFDIMHGVQWPPLMQALADRSynsdrtvqHPPPMLR 244
                                666666665554355************************99899*************************766666655699*** PP

                       GRAS 144 iTgvgspesgskeeleetgerLakfAeelgvpfefnvl....vakrledleleeLrvkpgEalaVnlvlqlhrlldesvslese 223
                                iT+ g+    s + l +tg+rL kfA++lg+ f+f++l    +++  + +++++L + p+EalaVn+vl lh+l+ ++      
  Pav_sc0000206.1_g120.1.mk 245 ITATGH----SLTLLLKTGDRLLKFANSLGLAFHFHPLvlndAVRPSDIISPSTLGLLPNEALAVNCVLYLHTLVTDDSREL-- 322
                                ******....9***************************666666678999************************95555544.. PP

                       GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerre 307
                                 + +L+ +ksl+Pkv++++++ea hn++ F++rf+eale+y a+fdslea+lp++s+er+ vE +++grei++vv +e+ +rr+
  Pav_sc0000206.1_g120.1.mk 323 -SLFLRKIKSLNPKVLTIANKEAYHNHPLFFNRFVEALEHYGAVFDSLEATLPPNSRERQAVEDVWMGREIRDVVGAEEGRRRQ 405
                                .59********************************************************************************* PP

                       GRAS 308 rhetlek.WrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                                rhe++e+ W+ +l++aGF++v+ls +a +qaklllr ++ s+gy++   ++s++lgW++rpL+svS+W
  Pav_sc0000206.1_g120.1.mk 406 RHEKYETyWEVMLRRAGFENVALSPFALSQAKLLLRLHYpSEGYQLRIINDSFFLGWQNRPLFSVSSW 473
                                ****9866************************************************************ PP

Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    
MLMGSFNSSH LQQQEEQVPL EDQQEDHPHH NYQLPNISNI SDLQLYHHNH HHLHAHQISH  60
QPFVMPRGLM TTSPTHMRQL LITCAELISQ LDFSSARRLI SLLSSKSSPF GDSTERLTYQ  120
FVKALSLRLN NPNPSSSAAL TTAATAAASS SSNYLLLEEE DDNNNEEALH SCYLTLNRIT  180
PFIRFSHLTA NQAILEAIDS SHHSIHILDF DIMHGVQWPP LMQALADRSY NSDRTVQHPP  240
PMLRITATGH SLTLLLKTGD RLLKFANSLG LAFHFHPLVL NDAVRPSDII SPSTLGLLPN  300
EALAVNCVLY LHTLVTDDSR ELSLFLRKIK SLNPKVLTIA NKEAYHNHPL FFNRFVEALE  360
HYGAVFDSLE ATLPPNSRER QAVEDVWMGR EIRDVVGAEE GRRRQRHEKY ETYWEVMLRR  420
AGFENVALSP FALSQAKLLL RLHYPSEGYQ LRIINDSFFL GWQNRPLFSV SSWH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-109GRAS family protein