PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000157.1_g110.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 555aa    MW: 62416.8 Da    PI: 7.0874
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000157.1_g110.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.83.5e-1371795491374
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l+++L+ cA+av+++dl laq+++ +l++++s +g+p+qRl ay++e+L ar a+s+s++ykal+++e +   sse l++++++
  Pav_sc0000157.1_g110.1.mk 179 LKQVLIFCAKAVADNDLLLAQWMMDELRQMVSVSGEPIQRLGAYLLEGLVARRASSGSNIYKALRCKEPA---SSELLSYMHIL 259
                                5799*****************************************************************9...9********** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLa 166
                                +ev+P++kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg++++ s   +   l+ +g+rL+
  Pav_sc0000157.1_g110.1.mk 260 YEVCPYFKFGYMSANGAIAEAMKDENRVHIIDFQIGQGSQWLTLIQAFAARPGGPPHIRITGIDDSMSAyaRGGGLNIVGKRLS 343
                                *****************************************************************888789999********** PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                k+Ae ++vpfef++ +a +  +++l++L v+pgEala n++++lh+++desvs++++rd++L+lvkslsPkvv++veqe+++n+
  Pav_sc0000157.1_g110.1.mk 344 KLAELFKVPFEFHA-AAMSGCEVQLKHLGVRPGEALAMNFAFMLHHMPDESVSTQNHRDRLLRLVKSLSPKVVTLVEQESNTNT 426
                                **************.89999**************************************************************** PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + F+ rf+e+l+yy+a+f+s++++l r+++eri+vE+++l+re+vn++aceg er+erhe l+kWr r+ +aGF+p+pls+ ++
  Pav_sc0000157.1_g110.1.mk 427 AAFFPRFVETLNYYTAMFESIDVTLRRDHKERINVEQHCLAREVVNIIACEGVERVERHELLGKWRLRFAMAGFTPYPLSSLVN 510
                                ************************************************************************************ PP

                       GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +++k+ll ++++  yr++e++g+l+lgWk+r Lv+ +aW+
  Pav_sc0000157.1_g110.1.mk 511 ATIKTLLDNYSD-KYRLQERDGALYLGWKNRDLVASCAWK 549
                                ***********5.5*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    
MQASKHHRSS GMSNRLCYQP VQEVEAYCLP RFQTLDPQVH YNNESSQSTV FSAQNFHIKY  60
CTLESSAANG SYTVYNSPST VNFSPNGSPM SQQDSHSYPT PDQYHSPDQN YSSPISGSCI  120
TDDATDFKYK LKQLETVMLG PDSNILDNYC STFQNGTSNT LPETDSWGQI MDSISKRDLK  180
QVLIFCAKAV ADNDLLLAQW MMDELRQMVS VSGEPIQRLG AYLLEGLVAR RASSGSNIYK  240
ALRCKEPASS ELLSYMHILY EVCPYFKFGY MSANGAIAEA MKDENRVHII DFQIGQGSQW  300
LTLIQAFAAR PGGPPHIRIT GIDDSMSAYA RGGGLNIVGK RLSKLAELFK VPFEFHAAAM  360
SGCEVQLKHL GVRPGEALAM NFAFMLHHMP DESVSTQNHR DRLLRLVKSL SPKVVTLVEQ  420
ESNTNTAAFF PRFVETLNYY TAMFESIDVT LRRDHKERIN VEQHCLAREV VNIIACEGVE  480
RVERHELLGK WRLRFAMAGF TPYPLSSLVN ATIKTLLDNY SDKYRLQERD GALYLGWKNR  540
DLVASCAWKC KPSTN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.10.0GRAS family protein