PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000130.1_g670.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 944aa    MW: 106356 Da    PI: 6.2782
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000130.1_g670.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.23.7e-875799422374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                 + Ll++Ae v  +++e+a++lL r + +as +g+p+qR+++yf+eAL++r+ r++ ++ ++ +  + s +  s++   + +++
  Pav_sc0000130.1_g670.1.mk 579 AHILLAAAEKVGYQQFERANRLLLRCEWIASFKGNPIQRVVFYFAEALRERIERETGSIPSKAEEMSISGHGLSTN-LTYLAYH 661
                                699***************************************************7777766665555554334444.4445699 PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakf 168
                                +  P++ + ++t  qaI e+v+ e++vH iD++i  G+QW  L+++La+R+e p   l iT+vg    + k+++eetg+rL+++
  Pav_sc0000130.1_g670.1.mk 662 QEVPFHSVMQFTGIQAIIESVALESKVHLIDLEIRSGVQWTGLMESLAEREECPVeLLTITAVGV---EGKQKIEETGKRLTSV 742
                                999************************************************7666489*******...589************* PP

                       GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                                Ae+l++pf+f++++++++ed++ + ++v+ +Ea+aV   l l ++ +++ +le+    +++++++l P ++vv+e ea+hns+s
  Pav_sc0000130.1_g670.1.mk 743 AESLNIPFQFKAVIVSAMEDIKDQLFDVEDDEAVAVYAPLILRTMISRPSCLEN----LMRVMRNLTPCIMVVIEVEANHNSPS 822
                                **********************************************88888888....************************** PP

                       GRAS 253 FlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                                F++rf++al +ysa+fd+le+ +  ++ee +++ +  ++++i+n+va+eg+er++r  +   Wr+ + ++ + ++++s+    q
  Pav_sc0000130.1_g670.1.mk 823 FVNRFIDALFFYSAFFDCLETCM--KQEEYRVLTEGSFREAIRNIVAAEGSERVARSVKIDVWRAFFARFRMVEMNFSNASLYQ 904
                                *********************96..556666666666*********************************************** PP

                       GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                a+l+ ++++    +++ + ++l+ gWk+ p+ svSaW+
  Pav_sc0000130.1_g670.1.mk 905 ASLVAKRFGCPSCTLDRNGKCLTVGWKETPIHSVSAWK 942
                                *********999*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 944 aa     Download sequence    
MSFQNYLDWE QRAKKLLMSL TSFLKQPFHT LTITLLSLLL PLSFLLLARL SCANYLLSLS  60
FAPLHPDPNY STTTTSSTLF SLFRYATPSL LYILVSIVST AALIHCLTGK ITIITEFPTP  120
IFRPRLYTAW IFLCTLQVCV GLGIEGSIAA GINGATFGSV DERICLLSRA IFFVGLHETM  180
LHWCRVVVKP VVDDTVFGAA RGEKWVERVA VAASFGCLWW WRLRDEMESL VVVAKAKREL  240
SMGIGVADFV GWWLYYLTVT IGMVRVVKGV MWLSMVLLCR RRSGGGNFAN SCAEDHDLQD  300
NKNMANAFFP FTPFDFGVLG GLTPQLEDYE KDQEVAFKVK PGHLFAIEEL GLGEMDSALS  360
SEHGFYQEDS KAKKGGLSSH FSKDPKPTYS LSDNFNFDIV SSEHVFHQSN KSEKGLPHLS  420
KDQDHRHYQQ HHHYQQQQPK SNYSILDDFN FDSVFPPAQP IQDGTHQLTY NQIGGSDIAE  480
TNKHLPHQSS LAVLELLNSY GSAFKKLRGE RTSSDTGNEA EASSYVGQQK LSTEEIMRVA  540
GARYVQFSNQ GYDDFYPLHP FGYALSGLSE EETKDAELAH ILLAAAEKVG YQQFERANRL  600
LLRCEWIASF KGNPIQRVVF YFAEALRERI ERETGSIPSK AEEMSISGHG LSTNLTYLAY  660
HQEVPFHSVM QFTGIQAIIE SVALESKVHL IDLEIRSGVQ WTGLMESLAE REECPVELLT  720
ITAVGVEGKQ KIEETGKRLT SVAESLNIPF QFKAVIVSAM EDIKDQLFDV EDDEAVAVYA  780
PLILRTMISR PSCLENLMRV MRNLTPCIMV VIEVEANHNS PSFVNRFIDA LFFYSAFFDC  840
LETCMKQEEY RVLTEGSFRE AIRNIVAAEG SERVARSVKI DVWRAFFARF RMVEMNFSNA  900
SLYQASLVAK RFGCPSCTLD RNGKCLTVGW KETPIHSVSA WKFR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-49GRAS family protein