PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000099.1_g940.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 509aa    MW: 55609.3 Da    PI: 4.5078
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000099.1_g940.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS505.4e-16176263292
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                 ++Ll+cA+ ++++d  +a + L rl+e +s +gdp++R+ +yfteAL++r+++   +  k+l++++t ++  ++ + ++k+++
  Pav_sc0000099.1_g940.1.mk 176 LKALLDCAR-LAESDPDRAVKSLIRLRESVSDRGDPTERVGFYFTEALQSRVLS--LQSEKSLAATTTYDTACEDFTLSYKALN 256
                                689******.566699999***********************************..6666778888888888************ PP

                       GRAS  86 evsPilk 92 
                                +++P+ k
  Pav_sc0000099.1_g940.1.mk 257 DACPYSK 263
                                ****976 PP

2GRAS200.97.5e-62291509154374
                       GRAS 154 skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPk 237
                                   +l +tg+rL++fA+ l+++fef++ + + +++l+ + +rv+p+EalaVnl+lql++llde+ +  +   + Lkl ksl+Pk
  Pav_sc0000099.1_g940.1.mk 291 PVASLFATGNRLREFAKLLELNFEFEP-ILTPVQELDESCFRVEPDEALAVNLMLQLYNLLDETPTAVQ---SALKLAKSLNPK 370
                                5567889********************.799******************************99999998...9*********** PP

                       GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerle 320
                                +v++ e ea++n+  F  rf +al+yy+alf+sle ++ r+s er kvE+ llgr+i  vv  e+   +rer e +e+W+  +e
  Pav_sc0000099.1_g940.1.mk 371 IVTLGEYEANLNRVAFTSRFKNALKYYTALFESLEPNMTRDSPERLKVEKLLLGRRIGGVVGPEQPGtKRERFEDKEQWKYLME 454
                                ***************************************************************998769*************** PP

                       GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                                ++GF+pv+ls++a++qak ll ++++  y++ e+   ++ l W++ pL++vS+Wr
  Pav_sc0000099.1_g940.1.mk 455 SSGFEPVALSHYAVSQAKILLWNYNNSLYSLIESPPGFLsLAWNEVPLFTVSSWR 509
                                *************************999999888666666**************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    
LGYGLTGSGF PDPFQLSGSS DAGGEPGFPF PNLDHHPTGF RFSDLGGGGA AEFDSDEWMD  60
SIIGGGDSTD SSNLPSACDT WHGSNADFGL YGADPFQPPC PSRLSNPCSP PSDLNRVIFS  120
ETQNQLPAWT APPPPPPTPH VVVKQAKSAD PPPPQPNDAV GVSSRSPEIE SAPPLLKALL  180
DCARLAESDP DRAVKSLIRL RESVSDRGDP TERVGFYFTE ALQSRVLSLQ SEKSLAATTT  240
YDTACEDFTL SYKALNDACP YSKPWRPGRP ENPAEFGSPS GIPAPSLGTS PVASLFATGN  300
RLREFAKLLE LNFEFEPILT PVQELDESCF RVEPDEALAV NLMLQLYNLL DETPTAVQSA  360
LKLAKSLNPK IVTLGEYEAN LNRVAFTSRF KNALKYYTAL FESLEPNMTR DSPERLKVEK  420
LLLGRRIGGV VGPEQPGTKR ERFEDKEQWK YLMESSGFEP VALSHYAVSQ AKILLWNYNN  480
SLYSLIESPP GFLSLAWNEV PLFTVSSWR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-156GRAS family protein