PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000030.1_g1410.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 492aa    MW: 53801.7 Da    PI: 5.5251
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000030.1_g1410.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.52.9e-1041054831374
                        GRAS   1 lvelLlecAeavssgdle..laqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn...ssee 77 
                                 lv+lL+++Aea++  +++  la+ +L rl+el+sp++ ++m+RlaayfteAL+  l + +    k l  + +++++    +++
  Pav_sc0000030.1_g1410.1.mk 105 LVHLLMAAAEALTGANKSrdLARVILVRLKELVSPTDgTNMERLAAYFTEALQGLLEGAGGVQGKHLIGNGAHRDHghhPTDV 187
                                 68**********997776669***********9987769******************965555555543333333344599** PP

                        GRAS  78 laalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesg..ske 156
                                 +aa++l++++sP++kf+h+taNqaIleav +++rvH++D+di++G+QW++L+qaL sR++gpp  +lRiT++++  sg  s  
  Pav_sc0000030.1_g1410.1.mk 188 IAAFQLLQDMSPYVKFGHFTANQAILEAVVHDRRVHVVDYDIMEGIQWASLMQALVSRKDGPPtpHLRITALSRGGSGrrSIG 270
                                 ***********************************************************776556*********888898999 PP

                        GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvv 239
                                 +++etg+rL+ fA+++  pf+f+    ++ e++++++L++ +gEal++n++l+l ++  +s ++     ++L+  k l+P++v
  Pav_sc0000030.1_g1410.1.mk 271 TIQETGRRLTAFAASISQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNLPHFSYRSPDSIA---SFLSGAKALNPRLV 350
                                 ************************9999*****************************966665555...9************* PP

                        GRAS 240 vvveqeadh.nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                 ++ve+e+   +++ F++rf+++l++ysa++dslea++p +s++r+ vEr++lg++i   ++   ++   + e   +W+e+l++
  Pav_sc0000030.1_g1410.1.mk 351 TLVEEEVRPaGDGGFVARFMDSLYHYSAVYDSLEAGFPMQSRARALVERVFLGPRIAGSLSRIYRA---NGEVGCSWSEWLGA 430
                                 *******999*****************************************************999...888999******** PP

                        GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveee.sgslvlgWkdrpLvsvSaWr 374
                                 +GFkp+p+s  + +qaklll  ++ dgyrvee  ++ lvlgWk+r L+s+S W+
  Pav_sc0000030.1_g1410.1.mk 431 VGFKPMPISFANHCQAKLLLGLFN-DGYRVEEVgNHRLVLGWKSRCLLSASIWT 483
                                 ************************.******87588899**************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    
MAMAIDQTFG GHAFDLDLSG CSSTTTNTMS SDHWYDWSPL AGDDFHELIE SMMEDQDGNE  60
LNSSSAQDEV HELEASNDTT SSGEIMMLTE EDGGANGEDS KGLRLVHLLM AAAEALTGAN  120
KSRDLARVIL VRLKELVSPT DGTNMERLAA YFTEALQGLL EGAGGVQGKH LIGNGAHRDH  180
GHHPTDVIAA FQLLQDMSPY VKFGHFTANQ AILEAVVHDR RVHVVDYDIM EGIQWASLMQ  240
ALVSRKDGPP TPHLRITALS RGGSGRRSIG TIQETGRRLT AFAASISQPF SFHQCRLDSD  300
ETFRPSALKL VKGEALVINC MLNLPHFSYR SPDSIASFLS GAKALNPRLV TLVEEEVRPA  360
GDGGFVARFM DSLYHYSAVY DSLEAGFPMQ SRARALVERV FLGPRIAGSL SRIYRANGEV  420
GCSWSEWLGA VGFKPMPISF ANHCQAKLLL GLFNDGYRVE EVGNHRLVLG WKSRCLLSAS  480
IWTSPPEFDC VN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-160GRAS family protein