PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_sc0000026.1_g470.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 769aa    MW: 84209.2 Da    PI: 5.9225
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_sc0000026.1_g470.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.11.4e-994107682374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                +++L+++Ae +++g+ +laq +Larl+++ sp g+p+qR+a+yf+eAL+  l+   ++  ++ + s+    + + ++ a+k fs
  Pav_sc0000026.1_g470.1.mk 410 IDQLFNAAELIETGNPALAQGILARLNHQLSPIGKPFQRAAFYFKEALQLLLHI-NTSSNSSNALSPF---SLIVKIDAYKSFS 489
                                689***********************************************9998.3333333444444...499********** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169
                                e+sP+l+f+++t+NqaIleaveg +rvH+iDfdi++G+QW++++q+ a R+ g+ps++iT++ s++++++ e+  t+e+L++fA
  Pav_sc0000026.1_g470.1.mk 490 EISPVLQFANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNCGAPSFKITAFISSTTHDEFEIGFTRENLKHFA 573
                                ****************************************************************9******************* PP

                       GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                                +el+++f+ +++  ++l+    + L ++  E +aV + l + ++ ++++sl+      L++vk+lsPk+vv  ++ +d+++ +F
  Pav_sc0000026.1_g470.1.mk 574 SELNLSFDLELVSLEALN-SGSWGLPLHVSEGVAVAVNLPIGSFSNNPLSLTM----ALRFVKQLSPKIVVSLDRGSDRTDVPF 652
                                **********97444444.4467776666777777777777888889999999....*************************** PP

                       GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                                ++++++al+ ys l++sl+a    + ++ +k+Er ll++ i+++v+ ++ +     ++   Wr  ++++GF+p+++s+++++qa
  Pav_sc0000026.1_g470.1.mk 653 AHQIIQALHSYSGLLESLDAV-NVNPDALQKIERYLLQPGIEKIVTGRHLS----PKRTPPWRTLFSSSGFSPLTFSNFTESQA 731
                                ******************665.34668999****************99998....9999************************* PP

                       GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                ++l++++++ g+++e+++ slvl+W+++ L+svS+Wr
  Pav_sc0000026.1_g470.1.mk 732 ECLVQRTPVGGFHIEKRQSSLVLCWQRKDLISVSVWR 768
                                ************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    
MKAMPLPFEQ FQGKGVLDFS SSTSDSQPPQ NQHLHHHHNQ QQQQKWNQNS NKENCYVGSI  60
EPTSVLDTRR SPSPPTSSST LSSSLGGGGG GASGGGGGGS GSTDTTTCLA TTAAAVYENI  120
SQTPLEESKC GQALGMEDWE SVLSESPGQE QSILRLIMSD IEDPSLGLNK LLQSGSGSDQ  180
QDLEFSAGFH DVVDQGGYDG FEPNTGNLVS NINVDPSLHA TSGSDFAFSN SSPNVQSTNV  240
RFGSSSSPST MFSASMNNPF PASLSPGMFQ QQQQHMGMDE KPQIFNPQMV MNQNQAQFTQ  300
NPAMFMPLTY AQLQEHHLLS PPPPKRLNSG GFGPNYPVQR APFTNPGQEL LVRAQQQHQH  360
QQQQLQFLPQ HLQQQRPTML AKENMLSPAE GTKEMMNQNQ NQQQLQQAAI DQLFNAAELI  420
ETGNPALAQG ILARLNHQLS PIGKPFQRAA FYFKEALQLL LHINTSSNSS NALSPFSLIV  480
KIDAYKSFSE ISPVLQFANF TCNQAILEAV EGFNRVHVID FDIGYGGQWA SFMQEVALRN  540
CGAPSFKITA FISSTTHDEF EIGFTRENLK HFASELNLSF DLELVSLEAL NSGSWGLPLH  600
VSEGVAVAVN LPIGSFSNNP LSLTMALRFV KQLSPKIVVS LDRGSDRTDV PFAHQIIQAL  660
HSYSGLLESL DAVNVNPDAL QKIERYLLQP GIEKIVTGRH LSPKRTPPWR TLFSSSGFSP  720
LTFSNFTESQ AECLVQRTPV GGFHIEKRQS SLVLCWQRKD LISVSVWRC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-140GRAS family protein