PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pav_co4073645.1_g010.1.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 542aa    MW: 60502 Da    PI: 4.7199
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pav_co4073645.1_g010.1.mkgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.37.6e-1391735422374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                ++lL++cA a+s+g+ + a++++++l++++s +gdp qR+aay++e+Laar+a+s++ +y++l+++e +   ss +laa+++++
  Pav_co4073645.1_g010.1.mk 173 KQLLYNCAGALSEGNIKGASTMISELRQMVSIQGDPAQRIAAYMVEGLAARVASSGKIIYRSLKCKEPP---SSYRLAAMQVLF 253
                                589*****************************************************************9...9*********** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                                ev+P++kf++++aN aI ea + e++vHiiDfdisqG Q+++L+q+La+R ++pp+lR+Tgv++pes+      l+ +g+rL+k
  Pav_co4073645.1_g010.1.mk 254 EVCPCFKFGFMAANGAIIEACKDEKKVHIIDFDISQGNQYITLIQTLANRLGKPPHLRLTGVDDPESVqrPVGGLNIIGQRLEK 337
                                ******************************************************************99888899********** PP

                       GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                                +Ae+l+vpfef++ va+r++ +++++L+++pgEal Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n++
  Pav_co4073645.1_g010.1.mk 338 LAEALKVPFEFQA-VASRTSIVNTSMLDCRPGEALLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLRPKLVTVVEQDVNTNTT 420
                                *************.7********************************************************************* PP

                       GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                                +F+ rf+ea +yysa+fdsl+a lpres++r++vEr++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s+++++
  Pav_co4073645.1_g010.1.mk 421 PFFPRFIEAYNYYSAVFDSLDAALPRESQDRMNVERQCLARDIVNIVACEGEERIERYEVAGKWRARMTMAGFTSCPMSTSITD 504
                                ************************************************************************************ PP

                       GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +++ l+r++ ++ y+v+ee g+l +gW++++L+++SaWr
  Pav_co4073645.1_g010.1.mk 505 SIRELIRQYCDR-YKVKEEAGALHFGWENKSLIVASAWR 542
                                **********66.*************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    
RPAELSATSY RNFKLYSLKG SNDSSTLSTQ TFISDKHKTL YAADPDSAES YENLLDSPME  60
EIAKPSSSGI SGNSTNPQDY FESQSPDADS FDEDKMRLKL QELERALLED NDDENDEEIN  120
CSSQSMEVDG EWTDPIQNEL LHDSPKESSS SESNVSSISS NKEITQASPQ TPKQLLYNCA  180
GALSEGNIKG ASTMISELRQ MVSIQGDPAQ RIAAYMVEGL AARVASSGKI IYRSLKCKEP  240
PSSYRLAAMQ VLFEVCPCFK FGFMAANGAI IEACKDEKKV HIIDFDISQG NQYITLIQTL  300
ANRLGKPPHL RLTGVDDPES VQRPVGGLNI IGQRLEKLAE ALKVPFEFQA VASRTSIVNT  360
SMLDCRPGEA LLVNFAFQLH HMPDESVSTV NQRDQLLRMV KSLRPKLVTV VEQDVNTNTT  420
PFFPRFIEAY NYYSAVFDSL DAALPRESQD RMNVERQCLA RDIVNIVACE GEERIERYEV  480
AGKWRARMTM AGFTSCPMST SITDSIRELI RQYCDRYKVK EEAGALHFGW ENKSLIVASA  540
WR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0GRAS family protein