PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G18880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 395aa    MW: 41668.4 Da    PI: 8.2378
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G18880.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32246301156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv a+++LGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OGLUM12G18880.1 246 KARRCWSPELHRRFVTALQRLGGPQAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 301
                      68****************************************************97 PP

2Myb_DNA-binding43.76.5e-14248299148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W++e++ ++v a ++lGg+   t+k I + m   g+t  ++ks++qky+
  OGLUM12G18880.1 248 RRCWSPELHRRFVTALQRLGGPqaaTPKQIRELMKvDGLTNDEVKSHLQKYR 299
                      568************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    
MGSSSASAAQ REEEAAAAAF VLGGVDMRML AARTATGALA RAGGGEAAAA AAAARFEDCI  60
RSLEAEKAKM EVFRRELPIS VHLIADVIEW LKDEVEKQRL LRRRQVEAPA AAPPPEMFAP  120
PATAKRKSAA SAAAEGVKAE ADANDKRSWM SSAQLWSCGS HTSTSTNNGG SVKKQQHKVS  180
NAFMPLATLP AFAKSLEKAD AAVPDLSLSS RVAMADAPAC PAAPSTTSSA VTDVAVAQRQ  240
QAVQRKARRC WSPELHRRFV TALQRLGGPQ AATPKQIREL MKVDGLTNDE VKSHLQKYRL  300
HTRRASDSGG GGGDHQTVGG RLWPPPPEQY TTSQHSTSQS GSPQGPLQLT VSSNHAVSVT  360
AGDSCDGGEE EEEEDGKSGS YSWEMQNGAR ASSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-30G2-like family protein