PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G00290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 313aa    MW: 34471 Da    PI: 7.8679
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G00290.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97e-3157110255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OGLUM12G00290.1  57 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 110
                      9****************************************************7 PP

2Myb_DNA-binding47.54.1e-1558109148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e+++ +v+av +lGg    t+k++ + m+  g++  ++ks++q+y+
  OGLUM12G00290.1  58 RLRWTPELHLSFVRAVDRLGGQdraTPKLVLQLMNvRGLSIGHVKSHLQMYR 109
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    
MEKTSAGKEE GSESKTAAAN NDGSSTSSTT EEEESGESQR RTSSSSSVRP YIRSKNPRLR  60
WTPELHLSFV RAVDRLGGQD RATPKLVLQL MNVRGLSIGH VKSHLQMYRS KKIDESGQVI  120
GGGSWRSSDE QQYHHLQMQG GGDGGQAYNL GHLSLPAALH HRHITAGSGT ILQSRVANAW  180
SPWRCHGSYW LRAGHHLLVG SKPYYPPPPA EARANTSSNH PDFVQGSSSS PDDHTMNHQR  240
PVVLKEMIYN EGSNHQGGPL NLDLSLDICP RGEKRKREFS WRKHEEDHDH TTIAIGGDQE  300
AESCATGLSL SLF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein