PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 321aa    MW: 35008.6 Da    PI: 7.7322
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G00320.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.3e-3161114255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OGLUM11G00320.1  61 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 114
                      9****************************************************7 PP

2Myb_DNA-binding47.54.2e-1562113148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e+++ +v+av +lGg    t+k++ + m+  g++  ++ks++q+y+
  OGLUM11G00320.1  62 RLRWTPELHLSFVRAVDRLGGQdraTPKLVLQLMNvRGLSIGHVKSHLQMYR 113
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    
MGSAGKQEEE EDGGGGAPAA AANNYGSSTT SSTTEEEGSG ESRRRTSSSS SVRPYVRSKN  60
PRLRWTPELH LSFVRAVDRL GGQDRATPKL VLQLMNVRGL SIGHVKSHLQ MYRSKKIDES  120
GQVIGGDSWR SDDHLPMQGG GHGGQAYNLG HLSLPALHHR SITAGSGTIF QSRFGNSWSP  180
WRCHGSYWLP AGHHLLVGSK PYYPPAAEAE APFRRSSARY VARANTSNHP DFVQGSSSSP  240
DDNIMNHQRP VLKEMICSEG SNHQEGPLNL DLSLDICPRG EKRKRECSWR KQEEDHDHAT  300
VAIGADQEAE SCATGLSLSL F
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-38G2-like family protein