PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G12240.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 290aa    MW: 33240.6 Da    PI: 6.6746
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G12240.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like857.8e-27147200155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k rl Wt++LH++F+ av++L G++kA+Pk+il +mkvk Lt+e+v+SHLQkYR+
  OGLUM10G12240.2 147 KSRLTWTTQLHRQFIAAVNHL-GEDKAVPKKILGIMKVKHLTREQVASHLQKYRM 200
                      68*******************.********************************8 PP

2Myb_DNA-binding41.92.4e-13149199148
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+ WTt+++ +++ av+ lG +   +k+I   m  k++t++q+ s++qky+
  OGLUM10G12240.2 149 RLTWTTQLHRQFIAAVNHLGEDkaVPKKILGIMKvKHLTREQVASHLQKYR 199
                      789***********************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    
MDHRELWPYG LRVLVIDDDC SYLSVMEDLL LKCSYKVMAS SGDTNTVMKY VANGASDFLL  60
KPVRIEELSN IWQHIFRKQI QDHKNNNMVG NLEKPGHPPS ILAMARATPA TTRSTATEAS  120
LAPLENEVRD DMVNYNGEIT DIRDLRKSRL TWTTQLHRQF IAAVNHLGED KAVPKKILGI  180
MKVKHLTREQ VASHLQKYRM QLKKSIPTTS KHGATLSSTA LDKTQDHPSR SQYFNQDGCM  240
EIMDYSLPRD NLSSGSECML EEQNDYSSEG FQDFRWDSDK QEYGPCFWNF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-34ARR-B family protein