PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G12240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 302aa    MW: 34547.2 Da    PI: 6.5842
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G12240.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98.4e-27159212155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k rl Wt++LH++F+ av++L G++kA+Pk+il +mkvk Lt+e+v+SHLQkYR+
  OGLUM10G12240.1 159 KSRLTWTTQLHRQFIAAVNHL-GEDKAVPKKILGIMKVKHLTREQVASHLQKYRM 212
                      68*******************.********************************8 PP

2Myb_DNA-binding41.82.5e-13161211148
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+ WTt+++ +++ av+ lG +   +k+I   m  k++t++q+ s++qky+
  OGLUM10G12240.1 161 RLTWTTQLHRQFIAAVNHLGEDkaVPKKILGIMKvKHLTREQVASHLQKYR 211
                      789***********************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    
MINGVIHSIE VIMDHRELWP YGLRVLVIDD DCSYLSVMED LLLKCSYKVM ASSGDTNTVM  60
KYVANGASDF LLKPVRIEEL SNIWQHIFRK QIQDHKNNNM VGNLEKPGHP PSILAMARAT  120
PATTRSTATE ASLAPLENEV RDDMVNYNGE ITDIRDLRKS RLTWTTQLHR QFIAAVNHLG  180
EDKAVPKKIL GIMKVKHLTR EQVASHLQKY RMQLKKSIPT TSKHGATLSS TALDKTQDHP  240
SRSQYFNQDG CMEIMDYSLP RDNLSSGSEC MLEEQNDYSS EGFQDFRWDS DKQEYGPCFW  300
NF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.12e-34ARR-B family protein