PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G09500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 325aa    MW: 33453.8 Da    PI: 7.451
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G09500.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32117170255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OGLUM09G09500.1 117 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 170
                      9****************************************************7 PP

2Myb_DNA-binding47.15.4e-15118169148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT  ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+y+
  OGLUM09G09500.1 118 RMRWTSTLHARFVHAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQMYR 169
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    
MGFYSSYHHP STWPSTSPSP LAAPPGAASS PLDPTAAFLS SPHHRMLSAA SGRLNGMLSV  60
SDTLRSYGVP GAAAPGVIGG AHHHHHHHHL HGGQPFVGAL ASRFMPKLPA KRSMRAPRMR  120
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKSTDKPAAS  180
SGPADGGSGD EEFAGGGQAA SGGGDSMCLR GGGGGGAAAA AFAEHGQSAS EGAASSVGGG  240
GGGGDMDQSS AGNTSTTRWS NSSRDPWLSS NSCNMDAHRS VGLSSPIENL EPCRSSSSQV  300
SNHELSSPSL EFTLGRPDWH GADHD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-44G2-like family protein