PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G05280.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 288aa    MW: 31407.7 Da    PI: 6.7278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G05280.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29e-342377155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OGLUM09G05280.2 23 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRL 77
                     58****************************************************8 PP

2Myb_DNA-binding63.44.3e-202576148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT e++e++v+av+qlGg+   t+k + r mg +g+t +++ks++qky+
  OGLUM09G05280.2 25 RLRWTNELHERFVEAVTQLGGPdraTPKGVLRIMGvQGLTIYHVKSHLQKYR 76
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    
MELGGNNMGP DNGANNNSNL AARQRLRWTN ELHERFVEAV TQLGGPDRAT PKGVLRIMGV  60
QGLTIYHVKS HLQKYRLAKY IPDSSADGNK AENKDPGDLL AGLEGSSGLQ ISEALKLQME  120
VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRLGGVK SETPAAGASV TLPSDQFPDS  180
ERTDPSTPAP TSESPTQGVP SNRDNGGRNE ATKSPQRDDS LSRHEPLTPD SNCQPGSPTA  240
SPKHERAAKR QRGNGAEFSE TDFALPHSIF ESSSGSEFQQ CSMSYSGH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-81G2-like family protein