PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G05270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 250aa    MW: 27332.2 Da    PI: 8.8171
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G05270.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-333387155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
  OGLUM09G05270.1 33 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 87
                     79****************************************************8 PP

2Myb_DNA-binding68.98.8e-223586148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT++++e++vdav+qlGg+   t+ktI rtmg kg+tl ++ks++qky+
  OGLUM09G05270.1 35 RLRWTADLHERFVDAVAQLGGPekaTPKTILRTMGvKGLTLFHLKSHLQKYR 86
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    
MFPPGLIHHR PDGGEAGRAA GGGPSLVLTA DPKPRLRWTA DLHERFVDAV AQLGGPEKAT  60
PKTILRTMGV KGLTLFHLKS HLQKYRLGKQ SGKEASEQSK DASYLLDAQG GMSVSPRVST  120
QDVKENQEVK EALRAQMEMQ RRLHEQVEVQ KHVQIRMEAY QKYIDTLLEK ACKIVSEQLA  180
SSGFSISDND LPELSGGVMC GSADTLSSSI FHQLSVSPIN LHSPEGKPTP SGIEGQMILQ  240
KSPELKRKSC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-72G2-like family protein