PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G03810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 363aa    MW: 39322.8 Da    PI: 8.7039
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G03810.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.41.3e-2274118246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OGLUM09G03810.1  74 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHM 118
                      9*****************************************996 PP

2Myb_DNA-binding29.71.5e-0975117139
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkq 39 
                      r+rWTt ++  +v+av++lGg+   t+k++ + m+ k +tl +
  OGLUM09G03810.1  75 RMRWTTALHAHFVHAVELLGGHeraTPKSVLELMNvKDLTLAH 117
                      89**********************************9999876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    
MAPDLSLHIS PPSPAPATEP RLELGLADDT AVAAAKTTTD DERRRRPHQP IQTAHGFKKS  60
SGSGGGGKRS ARAPRMRWTT ALHAHFVHAV ELLGGHERAT PKSVLELMNV KDLTLAHMYR  120
TVKGTDRSCV AGHGQASRKM GFLMRRGLVA EVDSFDGFNN NNMVNTTSNN TTSRKSQSPG  180
EQQLQDLQSG WPPHYLASSE SDHLLMEQRL MQEIWKGAAA AAAHDHHDQE AATAAALHHD  240
QHVRRLDHIV AGRPPPPPAS SSSGGGGDTM ASSLDWLLAS RRQEQHKYGD RHYDDHDGGY  300
YTAAHRGQAA AAMSAAAAAA SGVVKDRRPS LEMSLGRQGW EISMEQRSSV ESSSKELTLL  360
KCL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.24e-30G2-like family protein