PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G16530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 373aa    MW: 40084.5 Da    PI: 6.3228
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G16530.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like31.15.2e-102346225
          G2-like  2 prlrWtpeLHerFveaveqLGGse 25
                     +rlrWt +LHerFv av++LGG++
  OGLUM08G16530.1 23 ARLRWTGQLHERFVLAVAELGGAD 46
                     7*********************97 PP

2Myb_DNA-binding37.55.6e-1224106145
                      TSSS-HHHHHHHHHHHHHTTTT.....................................-HHHHHHHHT.TTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.....................................tWktIartmg.kgRtlkqcksrwq 45 
                      r+rWT +++e++v av++lGg                                      t+k++ r m   g+tl+++ks++q
  OGLUM08G16530.1  24 RLRWTGQLHERFVLAVAELGGAdskphprafllllppltslimgmadrsalflgaiagaTPKSVLRAMAvPGLTLYHLKSHLQ 106
                      89******************99************************************************************9 PP

3G2-like37.64.9e-12761062151
          G2-like  21 LGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      LG +  AtPk++l++m v+gLtl+h+kSHLQ
  OGLUM08G16530.1  76 LGAIAGATPKSVLRAMAVPGLTLYHLKSHLQ 106
                      888999************************* PP

Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    
MSSQQQQQHA GEAPASAAAA ARARLRWTGQ LHERFVLAVA ELGGADSKPH PRAFLLLLPP  60
LTSLIMGMAD RSALFLGAIA GATPKSVLRA MAVPGLTLYH LKSHLQVRAC VRHAAGELSP  120
AADQLLANSV CIGSWFLTVL SSLPLLQKYR QAVSRGGNGG GGGSGSLNDR SSSSERQPAD  180
HDGDSAADEP RTIAYDGDSD GDTKEALRDS SRSMVQMQRE VQRKLQEQIE VQRHLQLRME  240
AQGRYLQSVL RRAQQVLADH SLASSPEAAT AELSELASAV DIECMSSSSP PRHHRQSAAT  300
DSCVTTTSSS EAESKAAGSK RLHTSDCTVE QPVQGKRAFN FLQRHNQADQ EEEQEEEYAG  360
AEDGSSSEID LNR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.33e-29G2-like family protein